Protein Info for H281DRAFT_05947 in Paraburkholderia bryophila 376MFSha3.1

Annotation: monosaccharide ABC transporter membrane protein, CUT2 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 39 to 60 (22 residues), see Phobius details amino acids 67 to 84 (18 residues), see Phobius details amino acids 90 to 109 (20 residues), see Phobius details amino acids 116 to 136 (21 residues), see Phobius details amino acids 156 to 175 (20 residues), see Phobius details amino acids 206 to 227 (22 residues), see Phobius details amino acids 234 to 253 (20 residues), see Phobius details amino acids 260 to 281 (22 residues), see Phobius details amino acids 287 to 305 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 42 to 299 (258 residues), 58.7 bits, see alignment E=2.6e-20

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 92% identity to bph:Bphy_5159)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MIX4 at UniProt or InterPro

Protein Sequence (311 amino acids)

>H281DRAFT_05947 monosaccharide ABC transporter membrane protein, CUT2 family (Paraburkholderia bryophila 376MFSha3.1)
MTLAITQARLRAMLPAISLVAVLIPILVMQPAVMSYFGSSLLLNLAVPIVLATLAQLAII
TVNDLDLSIGPFVSLVACIGATLLVKTPWLGALALVGCVLTYAAVGALVELRQIPSIVVT
LGLSFVWSGLAIVLLPSPGGTSPTWLGAAMNYQTPFIAAPIVWSVLIAIIGHLLLMRSSA
GVRVRGAGGNPRAMRRFGWSLVRSKATLYGVAGVFGVLSGLSLLGLTTSADANLALRYTL
LSIAAVILGGGEFMGGRVSVIGAVLGAITLTLAASFLAFLNISSDWQVGMQGAILIVVLS
LRVLLQRGERR