Protein Info for H281DRAFT_05925 in Paraburkholderia bryophila 376MFSha3.1

Annotation: diguanylate cyclase (GGDEF) domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 524 transmembrane" amino acids 40 to 59 (20 residues), see Phobius details amino acids 64 to 86 (23 residues), see Phobius details amino acids 98 to 117 (20 residues), see Phobius details amino acids 128 to 146 (19 residues), see Phobius details amino acids 154 to 172 (19 residues), see Phobius details amino acids 178 to 197 (20 residues), see Phobius details PF12860: PAS_7" amino acids 224 to 335 (112 residues), 58.8 bits, see alignment E=8.7e-20 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 341 to 502 (162 residues), 145.1 bits, see alignment E=8.3e-47 PF00990: GGDEF" amino acids 342 to 497 (156 residues), 147.5 bits, see alignment E=4.5e-47

Best Hits

KEGG orthology group: None (inferred from 78% identity to bug:BC1001_3768)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (524 amino acids)

>H281DRAFT_05925 diguanylate cyclase (GGDEF) domain-containing protein (Paraburkholderia bryophila 376MFSha3.1)
MAVNLSVSKSILATPPELGAAVSPSIRARLLATLFDNRRPLLMSVVASAFVAAVAYARLH
QPWAILWLLADAWVLLGRLSIIHAYTSHNRSSPLNPRPWAATYAPLCLTTSLMLGLGTMG
CVGTADTTLASLALMVASGILGGVASRNASVPRLAIAQICLVTIPIGLGALFSPIAGSWI
LVPPLLLYVGAMISIVQRHYRGLVALMIAEQKHAELAVRFDAALTHMPHGLCTIDRSGKV
AIANSRTAQLFGATLDTLKLNVPLPEFIGHLGFVQFGERLGQQFTEKCSAWLREKRRPLA
LALPNGRQLELTRNPVPDGSAVVIIEDVTERKHSEAKVLYLARHDSLTGLANRRELRERL
GKILSSARRGSDTRTAVLYLDLDGFKQVNDRHGHTAGDEVLEAVATRLIETLRHGEFAAR
LGGDEFAVIVENAALHAVVAIAERVIREIAKPYPLTAGGTIHIGTSIGIALAETQEPVDD
LIRRADEAMYSAKKAGKGTYRISHGQTELQTEPDADRDASVGTA