Protein Info for H281DRAFT_05921 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Sugar phosphate permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 transmembrane" amino acids 26 to 44 (19 residues), see Phobius details amino acids 62 to 79 (18 residues), see Phobius details amino acids 95 to 117 (23 residues), see Phobius details amino acids 128 to 152 (25 residues), see Phobius details amino acids 162 to 185 (24 residues), see Phobius details amino acids 197 to 217 (21 residues), see Phobius details amino acids 261 to 282 (22 residues), see Phobius details amino acids 295 to 317 (23 residues), see Phobius details amino acids 329 to 347 (19 residues), see Phobius details amino acids 353 to 372 (20 residues), see Phobius details amino acids 381 to 402 (22 residues), see Phobius details amino acids 420 to 438 (19 residues), see Phobius details PF07690: MFS_1" amino acids 33 to 402 (370 residues), 130.8 bits, see alignment E=3e-42

Best Hits

Swiss-Prot: 46% identical to TUB3_AGRVI: Putative tartrate transporter (ttuB) from Agrobacterium vitis

KEGG orthology group: None (inferred from 90% identity to bug:BC1001_4654)

Predicted SEED Role

"Nitrate/nitrite transporter" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MIX2 at UniProt or InterPro

Protein Sequence (450 amino acids)

>H281DRAFT_05921 Sugar phosphate permease (Paraburkholderia bryophila 376MFSha3.1)
MPTLTQAAAAPAVASEVEEQLYRKVLKRILPLLLLCYVVAYLDRVNVGFAKLQMLDALGF
SDSIYAVGASIFFWGYFLFEMPSNLLLHKYGARFWIARIMVTWGIVSSSLAFISPLSHFF
HVQTSTMFYILRFLLGVCEAGFFPGIILYMNYWFPARRQSVAMSGFLIAIPVSLTLGGVI
SGWLMENTHGLLGMGGWQWMLLLEGIPSILVAFVVLFRMGNGIQSANWLTASEKALLQRN
LEQESSKKTHSVAAALKSPRVWLLTFILLTFNTGFYGLAFWLPSIIKASGVKSTLNIGLL
TAIPYLSAVAAMIWNAWHSRKTGERRLHAAIPACIGGIALILSAAFANNVALSIVFLTIA
TCAILGLMPIYWTFPGQILSGTAAAAGIALINSVGNLSGFTGSMITSVAKDLTGNINNGT
YALGACLLVSCVLILSIPRSMLNRDSVERA