Protein Info for H281DRAFT_05891 in Paraburkholderia bryophila 376MFSha3.1

Annotation: carbohydrate ABC transporter membrane protein 1, CUT1 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 transmembrane" amino acids 32 to 56 (25 residues), see Phobius details amino acids 99 to 118 (20 residues), see Phobius details amino acids 127 to 150 (24 residues), see Phobius details amino acids 183 to 207 (25 residues), see Phobius details amino acids 228 to 249 (22 residues), see Phobius details amino acids 289 to 309 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 108 to 302 (195 residues), 69.8 bits, see alignment E=1.3e-23

Best Hits

Swiss-Prot: 31% identical to AMYD_BACSU: Putative ABC transporter permease protein AmyD (amyD) from Bacillus subtilis (strain 168)

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 98% identity to bpy:Bphyt_5637)

Predicted SEED Role

"Dihydroxyacetone ABC transport system, permease protein 2"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MKR6 at UniProt or InterPro

Protein Sequence (318 amino acids)

>H281DRAFT_05891 carbohydrate ABC transporter membrane protein 1, CUT1 family (Paraburkholderia bryophila 376MFSha3.1)
MLANKPFSSAEMKSPAAARAHTRLTGLSDRTIAWLFILPTILLLLAINIFPLIWALRLSF
TNFKSNMPSVPARFVGIDNYVDILTDEDIWYAMQVTARFVFWSVGLEVLLGFGLALLINR
QFRGHSFWTTLILLPMMLSPAVVGNFWTFLLQPQTGLFNDIVGFFTGIAPGSFQMIGDVS
LAPWTIVMVDTWMWTPYVMLICLAGLRSIPDYIYEAAEVDRATPWRQFWSITLPMTLPFL
MLAVLFRGIENFKMFDMVNLLTSGGPGSVTETVSITLKRAAFEKWQTGYSSALAIILFVT
VFGAANIYVKALNRVKQR