Protein Info for H281DRAFT_05885 in Paraburkholderia bryophila 376MFSha3.1

Annotation: dihydroxyacetone kinase DhaK subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 TIGR02363: dihydroxyacetone kinase, DhaK subunit" amino acids 1 to 325 (325 residues), 459.2 bits, see alignment E=3.5e-142 PF02733: Dak1" amino acids 18 to 324 (307 residues), 413 bits, see alignment E=3.2e-128

Best Hits

Swiss-Prot: 48% identical to DHAK1_LISIN: PTS-dependent dihydroxyacetone kinase 1, dihydroxyacetone-binding subunit DhaK (dhaK-1) from Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)

KEGG orthology group: K05878, dihydroxyacetone kinase, N-terminal domain [EC: 2.7.1.-] (inferred from 94% identity to bpy:Bphyt_5631)

Predicted SEED Role

"Phosphoenolpyruvate-dihydroxyacetone phosphotransferase (EC 2.7.1.121), dihydroxyacetone binding subunit DhaK" in subsystem Dihydroxyacetone kinases (EC 2.7.1.121)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.-, 2.7.1.121

Use Curated BLAST to search for 2.7.1.- or 2.7.1.121

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MIQ4 at UniProt or InterPro

Protein Sequence (329 amino acids)

>H281DRAFT_05885 dihydroxyacetone kinase DhaK subunit (Paraburkholderia bryophila 376MFSha3.1)
MKKFINHVDDFLAESLAGFAAAHGDLVVLNREPVFVRRKDLKPGKVALISGGGSGHEPLH
SGFVGHGMLDAACPGQIFTSPTPDQMMAAAKAVDTGAGVLFIVKNYSGDLMNFEMASEMS
EVPNAMVLINDDVAVENSSYTTGRRGVAGAVIVEKLVGSLAESGASLDECKAFGNRINKR
TASMGVAFSSCTVPAAGTLTFKIGDDEIEVGVGIHGEPGRRRAKFASADTIAAELLTAIV
DDLKPAAGAGVLVLVNGLGGTPLGELYLLFNSTRAWLEKRDLKIARVQVGSLTTSLEMAG
ASITLCMLDEQMTKHWDSAVHTPALRWGV