Protein Info for H281DRAFT_05873 in Paraburkholderia bryophila 376MFSha3.1

Annotation: amino acid ABC transporter ATP-binding protein, PAAT family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 26 to 173 (148 residues), 130.9 bits, E=5.5e-42

Best Hits

Swiss-Prot: 56% identical to GLNQ_GEOSE: Glutamine transport ATP-binding protein GlnQ (glnQ) from Geobacillus stearothermophilus

KEGG orthology group: None (inferred from 91% identity to bge:BC1002_0401)

MetaCyc: 56% identical to L-glutamine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-12-RXN [EC: 7.4.2.1]

Predicted SEED Role

"Glutamate transport ATP-binding protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.1

Sequence Analysis Tools

See A0A2Z5MIA5 at UniProt or InterPro

Protein Sequence (250 amino acids)

>H281DRAFT_05873 amino acid ABC transporter ATP-binding protein, PAAT family (Paraburkholderia bryophila 376MFSha3.1)
VSDSIHNKPVISLSGVSKSFGATRVLNDINLDVRAGEVLVLIGASGSGKSTVLRIMAGLE
TTDSGEVWVNEVPLHDPKRAREIRGHVGMVFQQFNLFPHKTALGNVTLALIKARGMSPAD
ARKRAMDSLDRVGLADRASHYPSQLSGGQQQRVAIARALAVEPGIMFFDEATSALDPELV
GEVTEVMRGLARDGMTMVVVTHEMGFARKTADRVLFMDKGVIAEQGDPEQIFVNPSNERT
RQFLSRVLDH