Protein Info for H281DRAFT_05855 in Paraburkholderia bryophila 376MFSha3.1

Annotation: ring-1,2-phenylacetyl-CoA epoxidase subunit PaaD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 183 PF01883: FeS_assembly_P" amino acids 17 to 77 (61 residues), 42 bits, see alignment E=4.5e-15 TIGR02159: phenylacetate-CoA oxygenase, PaaJ subunit" amino acids 24 to 182 (159 residues), 190.7 bits, see alignment E=8.1e-61

Best Hits

KEGG orthology group: K02612, phenylacetic acid degradation protein (inferred from 88% identity to bxe:Bxe_A0292)

Predicted SEED Role

"Phenylacetate-CoA oxygenase, PaaJ subunit"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MET0 at UniProt or InterPro

Protein Sequence (183 amino acids)

>H281DRAFT_05855 ring-1,2-phenylacetyl-CoA epoxidase subunit PaaD (Paraburkholderia bryophila 376MFSha3.1)
MTTSTTTPRADASVQRAWAVLEAVPDPEIPVVSIRELGILRDVRRAEDGALEVVITPTYS
GCPAMSQIAEDVAHALDVAELKPYRISTVLAPAWTTDWMTADAREKLRAYGIAPPTGNCG
SAAGPAGVQEKVLRFVPRALPAPSCPRCGSAHTERLAQFGSTACKALYRCIDCREPFDYF
KPY