Protein Info for H281DRAFT_05835 in Paraburkholderia bryophila 376MFSha3.1

Annotation: 3-hydroxyisobutyrate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 PF03446: NAD_binding_2" amino acids 2 to 155 (154 residues), 141.1 bits, see alignment E=6.7e-45 PF02826: 2-Hacid_dh_C" amino acids 3 to 115 (113 residues), 28.9 bits, see alignment E=1.4e-10 PF03807: F420_oxidored" amino acids 3 to 60 (58 residues), 37.6 bits, see alignment E=5.7e-13 PF14833: NAD_binding_11" amino acids 164 to 277 (114 residues), 55.5 bits, see alignment E=1.4e-18

Best Hits

Swiss-Prot: 41% identical to YFJR_BACSU: Uncharacterized oxidoreductase YfjR (yfjR) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 96% identity to bug:BC1001_3321)

Predicted SEED Role

"3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MEV7 at UniProt or InterPro

Protein Sequence (289 amino acids)

>H281DRAFT_05835 3-hydroxyisobutyrate dehydrogenase (Paraburkholderia bryophila 376MFSha3.1)
MDIGFIGLGEMGAAMVANILKAGHQVRVWNRSPERAQPLVDAGARLVATPAEAFAGDAVF
SMLADDAALREVVTASLLEHAPRGLIHVNMATISVALAEELATAHASRGVNYVAAPVLGR
PDVATAGKLTIVAGGPAESIDRVQPVFDAIGQKTWRIGSLPQQANVIKLAANFMLGAAVE
TLGEAAALVSGHGLAIQDFLDVITSGIFPGPVYAGYGKMIAEQSYEPALFKARLGLKDLR
LALAAADAVTTPLPIASVVRDSLLEAVAHGDGEKDFAVLGQVAARRAGR