Protein Info for H281DRAFT_05822 in Paraburkholderia bryophila 376MFSha3.1

Annotation: NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 17 to 205 (189 residues), 83.8 bits, E=1.8e-27
• PF08659: KR
  • amino acids 19 to 107 (89 residues), 24.6 bits, E=3.3e-09
• PF13561: adh_short_C2
  • amino acids 23 to 258 (236 residues), 100.1 bits, E=2.3e-32

Best Hits

KEGG orthology group: None (inferred from 91% identity to bug:BC1001_3334)

Predicted SEED Role

"FolM Alternative dihydrofolate reductase 1" in subsystem Folate Biosynthesis

MetaCyc Pathways

• superpathway of tetrahydrofolate biosynthesis and salvage (11/12 steps found)
• superpathway of tetrahydrofolate biosynthesis (9/10 steps found)
• folate transformations III (E. coli) (8/9 steps found)
• folate transformations II (plants) (9/11 steps found)
• dTMP de novo biosynthesis (mitochondrial) (3/3 steps found)
• tetrahydrofolate biosynthesis I (3/3 steps found)
• superpathway of chorismate metabolism (43/59 steps found)

Protein Sequence (272 amino acids)

>H281DRAFT_05822 NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family (Paraburkholderia bryophila 376MFSha3.1)
MTASIDTAAAREPETPRVVLITGAARRIGRSLALGFAARGWDVAVHYGASRGEAEEVVAE
IARMGRRAVALHAELSDEAQVAALLPACTAALGRPVCIVNNASSFEEDTPRNVGYELLLK
LTAINLGAPLVLARMLFDATPQAAHADETQRSVVINVLDQKLYNMNPDYLSYTLSKAALQ
TATIALAQALAPKVRVVGLAPGLTMQSADQTAESFAAAHRVTPLGRASRPEDIVAAALYL
ADATGVTGTTLVVDGGQHLVPLPRDVMFLTGF