Protein Info for H281DRAFT_05815 in Paraburkholderia bryophila 376MFSha3.1

Annotation: 5,10-methenyltetrahydrofolate synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02727: 5-formyltetrahydrofolate cyclo-ligase
  • amino acids 6 to 171 (166 residues), 122.1 bits, E=1.2e-39
• PF01812: 5-FTHF_cyc-lig
  • amino acids 23 to 171 (149 residues), 102 bits, E=2e-33

Best Hits

KEGG orthology group: None (inferred from 89% identity to bgf:BC1003_3302)

Predicted SEED Role

"5-formyltetrahydrofolate cyclo-ligase (EC 6.3.3.2)" in subsystem Folate Biosynthesis or One-carbon metabolism by tetrahydropterines or Serine-glyoxylate cycle (EC 6.3.3.2)

MetaCyc Pathways

• folate transformations III (E. coli) (8/9 steps found)
• folate transformations II (plants) (9/11 steps found)
• folate transformations I (8/13 steps found)

KEGG Metabolic Maps

• One carbon pool by folate

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.3.2

Protein Sequence (180 amino acids)

>H281DRAFT_05815 5,10-methenyltetrahydrofolate synthetase (Paraburkholderia bryophila 376MFSha3.1)
MLLEARLQAASEPTNNAALGRCVLDALKHFDVQSVGFYWPLAGEFDARAAISVWLTGSTQ
REASLPIIKERGLPLEFHAWSPDTPMKIGHHKIAEPSTGRMVTPELLLVPCVGFDADGYR
LGYGGGYYDRTLAGWPGAKKPITVGVAYEACRTSALEREVHDIPLDMIVTEAGLHARSVG