Protein Info for H281DRAFT_05811 in Paraburkholderia bryophila 376MFSha3.1

Annotation: UPF0271 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03746: LamB_YcsF
  • amino acids 3 to 236 (234 residues), 324.2 bits, E=2.9e-101

Best Hits

Swiss-Prot: 96% identical to PXPA_PARPJ: 5-oxoprolinase subunit A (pxpA) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K07160, UPF0271 protein (inferred from 98% identity to bug:BC1001_3345)

MetaCyc: 62% identical to 5-oxoprolinase component A (Escherichia coli K-12 substr. MG1655)
5-oxoprolinase (ATP-hydrolyzing). [EC: 3.5.2.9]

Predicted SEED Role

"Lactam utilization protein LamB"

MetaCyc Pathways

• γ-glutamyl cycle (5/6 steps found)
• 5-oxo-L-proline metabolism (5/6 steps found)

KEGG Metabolic Maps

• Glutathione metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.2.9

Sequence Analysis Tools

See A0A2Z5MEK3 at UniProt or InterPro

Protein Sequence (250 amino acids)

>H281DRAFT_05811 UPF0271 protein (Paraburkholderia bryophila 376MFSha3.1)
MEIDLNADLGEGCGSDEALLDLVSSANIACGWHAGGANAMRDCVRWAVQKGVSIGAHPSF
NDPENFGRKEMDLPAADIYAGVLYQLGALSAIAQAEGGRIAHVKPHGALYNQAARDAKIA
DAIVSAVHDFDPSVAVFALANSGLVTAARNAGLTAIEEVFADRGYRADGSLVPRKEPGAL
LEDEDEVLERTLAMVREQRVRAVDGQWVPLNAQTICLHGDGPHALAFARRIRSALQQAGI
EVHAAGAASV