Protein Info for H281DRAFT_05810 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Uncharacterized membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 transmembrane" amino acids 6 to 22 (17 residues), see Phobius details amino acids 27 to 45 (19 residues), see Phobius details amino acids 57 to 76 (20 residues), see Phobius details amino acids 97 to 116 (20 residues), see Phobius details amino acids 163 to 185 (23 residues), see Phobius details amino acids 197 to 218 (22 residues), see Phobius details PF06149: DUF969" amino acids 8 to 223 (216 residues), 304.6 bits, see alignment E=1.8e-95

Best Hits

KEGG orthology group: None (inferred from 96% identity to bxe:Bxe_A0192)

Predicted SEED Role

"FIG015373: Membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MEX9 at UniProt or InterPro

Protein Sequence (249 amino acids)

>H281DRAFT_05810 Uncharacterized membrane protein (Paraburkholderia bryophila 376MFSha3.1)
MQTTVSLWPLIGVAVIIVGFLLRFNPMLIVAVAAIITGLAAHFPVEKILAEIGTGFIKTR
NIPLIILLPLAVIGLLERHGLRERAQTWISGIKAATAGRLLIVYLLVRELTAAVGLTGLG
GHPQMVRPLIAPMAEGATETRFGKISDAVRFKLRAFSAATDNVGLFFGEDIFVAFGAIVL
MTTFLKEAGIIVEPIHVAVWGIPTAICAFLIHGFRLYLLDRKLDRELRGNAHAGNATVSS
TQSAAGDKA