Protein Info for H281DRAFT_05809 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Uncharacterized membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 32 to 49 (18 residues), see Phobius details amino acids 55 to 76 (22 residues), see Phobius details amino acids 97 to 120 (24 residues), see Phobius details amino acids 131 to 151 (21 residues), see Phobius details amino acids 167 to 187 (21 residues), see Phobius details amino acids 207 to 225 (19 residues), see Phobius details amino acids 230 to 250 (21 residues), see Phobius details amino acids 255 to 277 (23 residues), see Phobius details amino acids 296 to 317 (22 residues), see Phobius details PF06166: DUF979" amino acids 7 to 317 (311 residues), 409.9 bits, see alignment E=3.5e-127

Best Hits

KEGG orthology group: None (inferred from 98% identity to bug:BC1001_3347)

Predicted SEED Role

"FIG001614: Membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MFA0 at UniProt or InterPro

Protein Sequence (318 amino acids)

>H281DRAFT_05809 Uncharacterized membrane protein (Paraburkholderia bryophila 376MFSha3.1)
MTLSITYLFWLLGVVLLIVGGMIVMDKEHPRRLTAGGFWILYALIFLIGDKLPPAVVGVA
VIVMAVIAGFGGVTAGKPRVLSLEARKASAARLRNKLFVPALTIPVITVIITLSASHLVF
GGVPLIEKANVTLIGFGIGCVIALAIACVLTRDTVGQSMKETRRLVDALSWAAVLPQMLG
MLGLVFSDAGVGKAVAHVTTAYISLDYRFIAVAVYCIGMALFTMVMGNGFAAFPVMTGGV
GVPILVGVFHGNPAVMVAIGMFSGYCGTLMTPMAANFNMVPAALLELPDKNAVIKVQIPT
ALTLLVVNIFLLNFLMFM