Protein Info for H281DRAFT_05808 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Tfp pilus assembly protein PilF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF14559: TPR_19
  • amino acids 8 to 68 (61 residues), 32.4 bits, E=8.2e-11
  • amino acids 147 to 204 (58 residues), 26.3 bits, 6.5e-09
• PF13432: TPR_16
  • amino acids 39 to 84 (46 residues), 21.9 bits, 1.7e-07
  • amino acids 137 to 187 (51 residues), 35.9 bits, 7.7e-12
  • amino acids 174 to 233 (60 residues), 34.7 bits, 1.8e-11
• PF00515: TPR_1
  • amino acids 65 to 98 (34 residues), 29.5 bits, see alignment (E = 3.9e-10)
  • amino acids 134 to 164 (31 residues), 32.7 bits, see alignment (E = 3.9e-11)
  • amino acids 167 to 200 (34 residues), 29.9 bits, see alignment (E = 3e-10)
• PF07719: TPR_2
  • amino acids 65 to 97 (33 residues), 29.6 bits, see alignment (E = 3.9e-10)
  • amino acids 134 to 165 (32 residues), 27.7 bits, see alignment (E = 1.6e-09)
  • amino acids 167 to 200 (34 residues), 28.7 bits, see alignment (E = 7.8e-10)
  • amino acids 201 to 233 (33 residues), 23 bits, see alignment (E = 5.1e-08)
• PF13181: TPR_8
  • amino acids 66 to 97 (32 residues), 18.7 bits, see alignment (E = 1.3e-06)
  • amino acids 99 to 131 (33 residues), 11.9 bits, see alignment (E = 0.0002)
  • amino acids 134 to 165 (32 residues), 24.1 bits, see alignment (E = 2.4e-08)
  • amino acids 167 to 200 (34 residues), 25.5 bits, see alignment (E = 8.2e-09)
  • amino acids 201 to 233 (33 residues), 12.4 bits, see alignment (E = 0.00013)
• PF13414: TPR_11
  • amino acids 77 to 113 (37 residues), 27.8 bits, 1.4e-09
  • amino acids 108 to 147 (40 residues), 32.7 bits, 4.1e-11
  • amino acids 145 to 181 (37 residues), 39.4 bits, 3.3e-13
  • amino acids 174 to 215 (42 residues), 43 bits, 2.5e-14
• PF13374: TPR_10
  • amino acids 99 to 127 (29 residues), 17.8 bits, see alignment (E = 2.2e-06)
  • amino acids 138 to 162 (25 residues), 19.3 bits, see alignment (E = 7.8e-07)
  • amino acids 172 to 197 (26 residues), 15.7 bits, see alignment (E = 1.1e-05)
• PF13174: TPR_6
  • amino acids 134 to 166 (33 residues), 13.4 bits, see alignment (E = 8.5e-05)
  • amino acids 168 to 199 (32 residues), 15.3 bits, see alignment (E = 2.2e-05)
• PF13176: TPR_7
  • amino acids 135 to 166 (32 residues), 14.1 bits, see alignment (E = 3.7e-05)
  • amino acids 169 to 199 (31 residues), 25.5 bits, see alignment (E = 7.9e-09)
• PF07721: TPR_4
  • amino acids 135 to 157 (23 residues), 16.3 bits, see alignment (E = 1e-05)
  • amino acids 167 to 192 (26 residues), 11 bits, see alignment (E = 0.00054)
• PF13424: TPR_12
  • amino acids 135 to 198 (64 residues), 32.2 bits, E=8.2e-11
• PF13431: TPR_17
  • amino acids 256 to 286 (31 residues), 25.3 bits, see alignment (E = 9.9e-09)
• PF01075: Glyco_transf_9
  • amino acids 485 to 526 (42 residues), 24.9 bits, 1e-08

Best Hits

KEGG orthology group: None (inferred from 85% identity to bug:BC1001_3348)

Predicted SEED Role

"FOG: TPR repeat"

Protein Sequence (577 amino acids)

>H281DRAFT_05808 Tfp pilus assembly protein PilF (Paraburkholderia bryophila 376MFSha3.1)
VNAALGAHQAGRLDTAESIYREILALAPTNSQALHYFGVLHYQRGQYADAAALMSNALKY
DRHDAACWSNRGLAAAALGHLDEATICYDQALQLQPDFADARNNFGTALQAQGALNEAVE
QYRLAIASNPALVDAHLNLGTALGKLGRFAEALACYRDALRVDPASAEAHFNAGNAYTAQ
GEREAAVASFERALALRPDYAEAHINLGSAIGKHGDYAGAESHYRRAVAIAPNPTNLVCL
GGSLGAQGRLDEEETFYREALARDPHYADAHQNLAWLLLKRGDFKQGWAEFALRWRKSDY
EALAIPGVAEWRGEPLNGRRVLIVGEQGFGDHFQFLRFARLLHERGATVDVCVREPLLSL
VQRMPGVHNAFSGEPEQNYDFWVPMTSVPSCVGTELSTIPAEVPYLFAHHAKVKTWRKKL
KKTGDAKRRAGLVWAGSPAFGNDRYRSMALADLHALADVANVDWYPLQKGPAHAQLAAAP
QAFRTHDFSGELNDFEDTAALIMNLDLVIAVDTAVAHLAGALGKPVWLLLPANSDWRWLE
ERSDSPWYPGMRLFRQKVLGEWAEVVKEVISAIDPAP