Protein Info for H281DRAFT_05805 in Paraburkholderia bryophila 376MFSha3.1

Annotation: dipeptide transport system ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 PF00005: ABC_tran" amino acids 21 to 179 (159 residues), 119.9 bits, see alignment E=2e-38 TIGR01727: oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain" amino acids 228 to 315 (88 residues), 71.6 bits, see alignment E=2.2e-24 PF08352: oligo_HPY" amino acids 230 to 294 (65 residues), 64.9 bits, see alignment E=1.1e-21

Best Hits

Swiss-Prot: 58% identical to DPPD_HAEIN: Dipeptide transport ATP-binding protein DppD (dppD) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K12371, dipeptide transport system ATP-binding protein (inferred from 97% identity to bgf:BC1003_3312)

MetaCyc: 62% identical to dipeptide ABC transporter ATP binding subunit DppD (Escherichia coli K-12 substr. MG1655)
ABC-8-RXN [EC: 7.4.2.9]

Predicted SEED Role

"Dipeptide transport ATP-binding protein DppD (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MGX9 at UniProt or InterPro

Protein Sequence (334 amino acids)

>H281DRAFT_05805 dipeptide transport system ATP-binding protein (Paraburkholderia bryophila 376MFSha3.1)
MDNLLTIRNLAVNFNGLPAVDRINLDVAPGEVLGVVGESGSGKSVTMMALMGLIDAPGKV
TADEITFNGRDLLKASAKERRKIIGKDIAMVFQDALTSLNPSYTVGYQIKEVLKLHEGLR
GAALDKRALELLDQVGIPDAKSRIGAFPHQMSGGMNQRVMIAMAIACNPKLLIADEPTTA
LDVTIQAQIMELLMRLQKERGMALVLISHDLAVVSEVAQRVAVMYAGEVIETNKVPDIFA
APHHPYTEALLAAIPEHNVGAVRLAALPGMVPGRDDRPKGCLFAPRCKYMVDDCNRGRPA
LAPMQGHAEVARVRCIKPLNLSGDANVHTHGGAR