Protein Info for H281DRAFT_05804 in Paraburkholderia bryophila 376MFSha3.1

Annotation: dipeptide transport system permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 transmembrane" amino acids 34 to 56 (23 residues), see Phobius details amino acids 103 to 129 (27 residues), see Phobius details amino acids 146 to 179 (34 residues), see Phobius details amino acids 222 to 247 (26 residues), see Phobius details amino acids 267 to 290 (24 residues), see Phobius details PF12911: OppC_N" amino acids 23 to 72 (50 residues), 50.7 bits, see alignment 1.3e-17 PF00528: BPD_transp_1" amino acids 119 to 302 (184 residues), 113.6 bits, see alignment E=9.4e-37

Best Hits

Swiss-Prot: 61% identical to DPPC_ECO57: Dipeptide transport system permease protein DppC (dppC) from Escherichia coli O157:H7

KEGG orthology group: K12370, dipeptide transport system permease protein (inferred from 99% identity to bgf:BC1003_3313)

MetaCyc: 61% identical to dipeptide ABC transporter membrane subunit DppC (Escherichia coli K-12 substr. MG1655)
ABC-8-RXN [EC: 7.4.2.9]

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MGF9 at UniProt or InterPro

Protein Sequence (305 amino acids)

>H281DRAFT_05804 dipeptide transport system permease protein (Paraburkholderia bryophila 376MFSha3.1)
MADIQNTVPTAVTPPSGRAIAAREFWANFSRNRGAVGAGIVVLLLIVVAIFAPLIAPHSP
IEQYRDFVKIPPAWLEGGNWRFVLGTDEAGRDILSRLMYGARLSFWIGFVSVVLALIPGV
VLGLIAAFFEKWADTPIMRIMDVLLALPSLLLAVAVVAIIGPGLVNTMLAIAIVALPGYV
RLTRASAQGELQKEYVTASRVAGAGTLRLMFSQVLPNCTAPLIVQATLGFSSAILDAAAL
GFLGLGVQPPSAEWGAMLASARDYIDSAWWIVTMPGLSILISVLAINLLGDGLRDALDPK
LKRMA