Protein Info for H281DRAFT_05803 in Paraburkholderia bryophila 376MFSha3.1

Annotation: dipeptide transport system permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 99 to 123 (25 residues), see Phobius details amino acids 135 to 158 (24 residues), see Phobius details amino acids 198 to 218 (21 residues), see Phobius details amino acids 256 to 277 (22 residues), see Phobius details amino acids 306 to 328 (23 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 1 to 102 (102 residues), 46.6 bits, see alignment E=3.6e-16 PF00528: BPD_transp_1" amino acids 114 to 334 (221 residues), 155.6 bits, see alignment E=1.2e-49

Best Hits

Swiss-Prot: 64% identical to DPPB_ECOL6: Dipeptide transport system permease protein DppB (dppB) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K12369, dipeptide transport system permease protein (inferred from 98% identity to bxe:Bxe_A0183)

MetaCyc: 64% identical to dipeptide ABC transporter membrane subunit DppB (Escherichia coli K-12 substr. MG1655)
ABC-8-RXN [EC: 7.4.2.9]

Predicted SEED Role

"Dipeptide transport system permease protein DppB (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MF56 at UniProt or InterPro

Protein Sequence (336 amino acids)

>H281DRAFT_05803 dipeptide transport system permease protein (Paraburkholderia bryophila 376MFSha3.1)
MFRFVLRRIGMVIPTFIGITILAFALIHLIPGDPIEVMMGERGVDPAMHAAAMHRLGLDE
PLPMQYVHYIGRALHGDLGTSIITNTSVMGEFLARFPATVELSICAMLFALIVGLPAGVF
AALRRGTAVDHGVMGTALTGYSMPIFWWGLILIMVFSVKLGWTPVSGRIAVEYDIPHVTG
FMLVDAMMSTDEGAFKSALSHLILPAIVLGTIPLAVVARMTRSSMLEVLREDYIRTARAK
GLSPGRVIVVHALRNALIPVVTVIGLQVGTLLAGAVLTETLFSWPGIGKWLIDAIGRRDY
PVVQGGILMIATLVIFVNLVVDLLYGVLNPRIRHTR