Protein Info for H281DRAFT_05799 in Paraburkholderia bryophila 376MFSha3.1

Annotation: adenosylhomocysteinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 473 PF05221: AdoHcyase" amino acids 13 to 472 (460 residues), 491.1 bits, see alignment E=2.3e-151 TIGR00936: adenosylhomocysteinase" amino acids 14 to 465 (452 residues), 611.7 bits, see alignment E=3e-188 PF00670: AdoHcyase_NAD" amino acids 234 to 393 (160 residues), 273.7 bits, see alignment E=1.2e-85 PF02826: 2-Hacid_dh_C" amino acids 253 to 343 (91 residues), 33.8 bits, see alignment E=4.3e-12 PF07991: IlvN" amino acids 255 to 317 (63 residues), 20.8 bits, see alignment E=5e-08

Best Hits

Swiss-Prot: 97% identical to SAHH_PARXL: Adenosylhomocysteinase (ahcY) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: K01251, adenosylhomocysteinase [EC: 3.3.1.1] (inferred from 97% identity to bpy:Bphyt_3758)

Predicted SEED Role

"Adenosylhomocysteinase (EC 3.3.1.1)" in subsystem Methionine Biosynthesis or Methionine Degradation (EC 3.3.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.3.1.1

Use Curated BLAST to search for 3.3.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MFB0 at UniProt or InterPro

Protein Sequence (473 amino acids)

>H281DRAFT_05799 adenosylhomocysteinase (Paraburkholderia bryophila 376MFSha3.1)
MNAAVIDSQASQDYIVADMSLADWGRKELTIAETEMPGLMQTRDEYKAQQPLKGARIAGS
LHMTIQTGVLIETLTALGADVRWASCNIFSTQDHAAAAIAKAGTPVFAFKGESLDEYWEF
SHRIFEWPNGEFANMILDDGGDATLLLILGSKAEKDRSVIAKPTNEEEVALYKSIERHLD
ADPTWYSTRLAHIQGVTEETTTGVHRLYQMEKEGRLPFPAINVNDSVTKSKFDNLYGCRE
SLVDGIKRATDVMIAGKIAVVAGYGDVGKGCAQSLRGLGATVWVTEIDPICALQAAMEGY
RVVTMEYAADKADIFVTATGNYHVINHDHMKAMRHNAIVCNIGHFDSEIDVASTRQYQWD
NIKPQVDHIIFPDGKRVILLAEGRLVNLGCATGHPSFVMSNSFTNQTLAQIELFTQGKKY
ENRVYVLPKHLDEKVARLHLARIGANLTVLSDAQAGYIGVDKNGPFKPNHYRY