Protein Info for H281DRAFT_05787 in Paraburkholderia bryophila 376MFSha3.1

Annotation: flagellar hook-basal body complex protein FliE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02049: FliE
  • amino acids 29 to 116 (88 residues), 95.8 bits, E=7.1e-32
• TIGR00205: flagellar hook-basal body complex protein FliE
  • amino acids 30 to 116 (87 residues), 79 bits, E=1.7e-26

Best Hits

Swiss-Prot: 71% identical to FLIE_BURM7: Flagellar hook-basal body complex protein FliE (fliE) from Burkholderia mallei (strain NCTC 10247)

KEGG orthology group: K02408, flagellar hook-basal body complex protein FliE (inferred from 94% identity to bgf:BC1003_3328)

Predicted SEED Role

"Flagellar hook-basal body complex protein FliE" in subsystem Flagellum or Flagellum in Campylobacter

Sequence Analysis Tools

See A0A2Z5MFB9 at UniProt or InterPro

Protein Sequence (116 amino acids)

>H281DRAFT_05787 flagellar hook-basal body complex protein FliE (Paraburkholderia bryophila 376MFSha3.1)
MTLPVNALSSALQQLQSMAAQAAGGSTAAADASAAGESGAATTGGFASALKASLDKISGD
QTKAVGESQAFELGASNVSLNDVMVDMQKANVGFQFGLQVRNKLVSAYNDIMQMQV