Protein Info for H281DRAFT_05783 in Paraburkholderia bryophila 376MFSha3.1

Annotation: flagellum-specific ATP synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 554 TIGR01026: ATPase, FliI/YscN family" amino acids 103 to 550 (448 residues), 586.9 bits, see alignment E=2.4e-180 TIGR03496: flagellar protein export ATPase FliI" amino acids 124 to 548 (425 residues), 647.3 bits, see alignment E=9.7e-199 PF00006: ATP-synt_ab" amino acids 259 to 470 (212 residues), 294.5 bits, see alignment E=4.6e-92 PF18269: T3SS_ATPase_C" amino acids 478 to 547 (70 residues), 86 bits, see alignment E=1.3e-28

Best Hits

Swiss-Prot: 70% identical to FLII_SALTY: Flagellum-specific ATP synthase (fliI) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02412, flagellum-specific ATP synthase [EC: 3.6.3.14] (inferred from 92% identity to bug:BC1001_3374)

Predicted SEED Role

"Flagellum-specific ATP synthase FliI" in subsystem Flagellar motility or Flagellum

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MGZ6 at UniProt or InterPro

Protein Sequence (554 amino acids)

>H281DRAFT_05783 flagellum-specific ATP synthase (Paraburkholderia bryophila 376MFSha3.1)
MVKPTLEEIRASDLTPLERELALASFGAEALADAPFADAVSTAATAADPGHAHPVTGAAA
SRESAPAAGAGLGASPAAAKAASAAAPAAYDPALDSNPHMQAWRGRLDALRARNAIAKPM
RACGRLTRAAGLVLEAVGLRLSVGAEVMIELPPGSSLPMAEAEVVGFSGDKLFLMPTTEV
IGLLPGARVYPLESAPIADPMAGAKRLPVGWELLGRVLDASGRPLDGLGPLGAHADAPLS
APVINPLNREPIHKVLDVGVRAINALLTVGRGQRMGLFAGSGVGKSVLLGTMARYTSAEV
IVIGLIGERGREVKEFIEQILGEEGLARSVVIAAPADVSPLLRMQAASYSTSLAEYFRDQ
GKHVLLLMDSLTRYAMAQREIALAVGEPPATKGYPPSVFAKLPALVERTGNGPAGGGSIT
AFYTVLTEGDDQQDPIADSARAILDGHIVLSRSLAEAGHYPAIDIEASISRAMTALIDDN
HLDKTRMFKQMLSRYQRNRDLINVGAYSSGRDALLDRAIALYPRMEAFLQQGFRECANFE
PSVEMLDALFAQGA