Protein Info for H281DRAFT_05763 in Paraburkholderia bryophila 376MFSha3.1

Annotation: flagellar basal-body rod protein FlgC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 141 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR01395: flagellar basal-body rod protein FlgC" amino acids 6 to 140 (135 residues), 170.6 bits, see alignment E=1.1e-54 PF00460: Flg_bb_rod" amino acids 10 to 38 (29 residues), 44.4 bits, see alignment 1.2e-15 PF06429: Flg_bbr_C" amino acids 88 to 138 (51 residues), 53.4 bits, see alignment E=2.1e-18

Best Hits

Swiss-Prot: 67% identical to FLGC_YEREN: Flagellar basal-body rod protein FlgC (flgC) from Yersinia enterocolitica

KEGG orthology group: K02388, flagellar basal-body rod protein FlgC (inferred from 96% identity to bpy:Bphyt_3793)

Predicted SEED Role

"Flagellar basal-body rod protein FlgC" in subsystem Flagellum or Flagellum in Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MH18 at UniProt or InterPro

Protein Sequence (141 amino acids)

>H281DRAFT_05763 flagellar basal-body rod protein FlgC (Paraburkholderia bryophila 376MFSha3.1)
MPSLMNIFGVAGSAMSAQSQRLNVTASNLANADSTTGPDGQPYKAKQVVFGVAPLGGARS
GSGQQVGGVQVTGVVDDPTPMKTAYDPGNPAANADGYVTLPNVDPVQEMVNMISASRSYQ
ANVETLNTAKTLMLKTLTIGT