Protein Info for H281DRAFT_05756 in Paraburkholderia bryophila 376MFSha3.1

Annotation: RNA polymerase, sigma 28 subunit, SigD/FliA/WhiG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 12 to 233 (222 residues), 109.8 bits, see alignment E=1.1e-35 TIGR02479: RNA polymerase sigma factor, FliA/WhiG family" amino acids 14 to 233 (220 residues), 288.1 bits, see alignment E=5.1e-90 PF04542: Sigma70_r2" amino acids 15 to 85 (71 residues), 58.2 bits, see alignment E=1.1e-19 PF04539: Sigma70_r3" amino acids 94 to 137 (44 residues), 38.8 bits, see alignment 1.7e-13 PF08281: Sigma70_r4_2" amino acids 178 to 229 (52 residues), 28.1 bits, see alignment E=2.6e-10 PF04545: Sigma70_r4" amino acids 182 to 230 (49 residues), 56.5 bits, see alignment 3.1e-19

Best Hits

Swiss-Prot: 56% identical to FLIA_YEREN: RNA polymerase sigma factor FliA (fliA) from Yersinia enterocolitica

KEGG orthology group: K02405, RNA polymerase sigma factor for flagellar operon FliA (inferred from 98% identity to bpy:Bphyt_3800)

Predicted SEED Role

"RNA polymerase sigma factor for flagellar operon" in subsystem Flagellar motility or Flagellum or Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MGA1 at UniProt or InterPro

Protein Sequence (244 amino acids)

>H281DRAFT_05756 RNA polymerase, sigma 28 subunit, SigD/FliA/WhiG (Paraburkholderia bryophila 376MFSha3.1)
MYNAQGKISQADVLTKYAPLVRRLGLQLVAKMPASVDLDDLIQAGMIGLLDAASRYKEDQ
GAQFETYASQRIRGAMLDELRSNDWLPRSLRRTSREVETAVHKVEQNLGRSASETEIAEH
LDMPLDEYQSMLQDLHGSQLIYYEDFDRSADDEPFLDRYCVDHSDPLSALLDDSLRSALV
EAIDRLPEREKLLMSLYYERGMNLREIGAVMEVSESRVCQLHSQAVARLRTRLREMAWAN
AEAT