Protein Info for H281DRAFT_05755 in Paraburkholderia bryophila 376MFSha3.1

Annotation: flagellar biosynthesis protein FlhG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 transmembrane" amino acids 23 to 44 (22 residues), see Phobius details PF01656: CbiA" amino acids 24 to 157 (134 residues), 25.9 bits, see alignment E=4.2e-10

Best Hits

KEGG orthology group: K04562, flagellar biosynthesis protein FlhG (inferred from 93% identity to bug:BC1001_3402)

Predicted SEED Role

"Flagellar synthesis regulator FleN" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MER0 at UniProt or InterPro

Protein Sequence (289 amino acids)

>H281DRAFT_05755 flagellar biosynthesis protein FlhG (Paraburkholderia bryophila 376MFSha3.1)
LDKLVSDQAEGLRRLLARSGSRVIAVTGGSLGAGCTATVMNLAVALAQQGKDVLVIDECV
GDKSVSAMLGSVRGAGNFAAVMRGEMTLDEAALRHALGFSVLAASRAHREGYSAAQFSVV
LRGSADIVLIDAQLDQQGHLSALAMQAHDVMIVTRMAAQAITDAYACMKRLHYAHAIAQF
RVLVNHVQSVEDARTAFANLAGVAGRYLAVALEDAGCIAADARMARAEELSRCVVDAFPS
TPAARDFRHLAAELQYWPMRPAMSSQTPWMAPAAVTAAQHADQPSAQHA