Protein Info for H281DRAFT_05747 in Paraburkholderia bryophila 376MFSha3.1

Annotation: two-component system, chemotaxis family, response regulator CheB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 362 PF00072: Response_reg" amino acids 6 to 108 (103 residues), 84.9 bits, see alignment E=4.4e-28 PF01339: CheB_methylest" amino acids 170 to 347 (178 residues), 226.3 bits, see alignment E=2.2e-71

Best Hits

Swiss-Prot: 97% identical to CHEB_PARXL: Protein-glutamate methylesterase/protein-glutamine glutaminase (cheB) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: K03412, two-component system, chemotaxis family, response regulator CheB [EC: 3.1.1.61] (inferred from 96% identity to bge:BC1002_3044)

MetaCyc: 68% identical to protein-glutamate methylesterase/protein glutamine deamidase (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Chemotaxis response regulator protein-glutamate methylesterase CheB (EC 3.1.1.61)" in subsystem Bacterial Chemotaxis (EC 3.1.1.61)

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.61

Use Curated BLAST to search for 3.1.1.61

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MFF7 at UniProt or InterPro

Protein Sequence (362 amino acids)

>H281DRAFT_05747 two-component system, chemotaxis family, response regulator CheB (Paraburkholderia bryophila 376MFSha3.1)
VQKIKVLCVDDSALIRSLMTEIINSQPDMTVVATAPDPLVARELIKQHNPDVLTLDVEMP
RMDGLDFLEKLMRLRPMPVVMVSSLTERGNEITLRALELGAVDFVTKPKVGIRDGMLDYS
EKLADKIRAAARARVRQAAPVHHAPAAAGHAPVGAAPLFNNPLLSTEKLIIVGASTGGTE
AIREVLVPLPPDAPAVLIAQHMPPGFTKSFAQRLNGLCRITVKEAEHGERVLPGHAYIAP
GHAHLLLARSGANYIAHLSDDPPVNRHRPSVDVLFRSAAQHAGKNAVGVILTGMGRDGAA
GLLDMKKAGAYTLAQDEASCIVFGMPREAIALGAADEIASLPDMCRRVMARLASMGDRVQ
RV