Protein Info for H281DRAFT_05746 in Paraburkholderia bryophila 376MFSha3.1

Annotation: chemotaxis protein CheD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 92% identical to CHED_PARXL: Probable chemoreceptor glutamine deamidase CheD (cheD) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: K03411, chemotaxis protein CheD [EC: 3.5.1.44] (inferred from 86% identity to bgf:BC1003_3369)

Predicted SEED Role

"Chemotaxis protein CheD" in subsystem Bacterial Chemotaxis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.44

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MGB2 at UniProt or InterPro

Protein Sequence (265 amino acids)

>H281DRAFT_05746 chemotaxis protein CheD (Paraburkholderia bryophila 376MFSha3.1)
MSSALPIATNLYYDNHFQRPGVKLLPNEFYTTHDDMVLVTVLGSCVAACIQDRTAGIGGM
NHFMLPDDGAEVGQAASDSMRYGAYAMEVLINELIKAGGRRDRFEAKVFGGGAVLAGMTT
INIGDRNSEFVRRYLALEKIRIVAEDLQGSHPRKVAFMPRTGQVMVKKLRLQQDPGVAER
EQALVRQTAEARAERLAAARKRVELFSAPAATKPKIELFGSSGGSGNGSGSTTANGAGAP
RSRIELFGSTPRPTNSTNARTAEEA