Protein Info for H281DRAFT_05725 in Paraburkholderia bryophila 376MFSha3.1

Updated annotation (from data): 2,3-dehydroadipyl-CoA hydratase / enoyl-CoA hydratase (EC 4.2.1.17)
Rationale: Specifically important for phenylacetate utilization. 51% identical to the characterized enzyme (paaF = Q845K2) from Pseudomonas sp. Y2, which is part of the aerobic phenylacetyl-CoA pathway. Also, 84% identical to enoyl-CoA hydratase Crt2 = H16_A3307 from Ralstonia eutropha (PMID:30243533).
Original annotation: short chain enoyl-CoA hydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 70% identical to ECHH_RHIME: Probable enoyl-CoA hydratase (fadB1) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K01692, enoyl-CoA hydratase [EC: 4.2.1.17] (inferred from 95% identity to bge:BC1002_2744)

MetaCyc: 65% identical to BadK (Rhodopseudomonas palustris)
4.2.1.-

Predicted SEED Role

"Phenylacetate degradation enoyl-CoA hydratase PaaA (EC 4.2.1.17)" (EC 4.2.1.17)

MetaCyc Pathways

oleate β-oxidation (29/35 steps found)
phenylacetate degradation I (aerobic) (9/9 steps found)
adipate degradation (5/5 steps found)
superpathway of phenylethylamine degradation (9/11 steps found)
benzoyl-CoA biosynthesis (3/3 steps found)
adipate biosynthesis (4/5 steps found)
benzoyl-CoA degradation I (aerobic) (5/7 steps found)
fatty acid β-oxidation I (generic) (5/7 steps found)
superpathway of glyoxylate cycle and fatty acid degradation (10/14 steps found)
valproate β-oxidation (6/9 steps found)
fatty acid β-oxidation II (plant peroxisome) (3/5 steps found)
fatty acid β-oxidation IV (unsaturated, even number) (3/5 steps found)
2-methyl-branched fatty acid β-oxidation (9/14 steps found)
methyl ketone biosynthesis (engineered) (3/6 steps found)
(8E,10E)-dodeca-8,10-dienol biosynthesis (6/11 steps found)
fatty acid β-oxidation VI (mammalian peroxisome) (3/7 steps found)
3-phenylpropanoate degradation (5/10 steps found)
benzoate biosynthesis I (CoA-dependent, β-oxidative) (4/9 steps found)
benzoate biosynthesis III (CoA-dependent, non-β-oxidative) (1/5 steps found)
benzoyl-CoA degradation III (anaerobic) (3/9 steps found)
(4Z,7Z,10Z,13Z,16Z)-docosapentaenoate biosynthesis (6-desaturase) (2/13 steps found)
docosahexaenoate biosynthesis III (6-desaturase, mammals) (2/14 steps found)
Spodoptera littoralis pheromone biosynthesis (4/22 steps found)
platensimycin biosynthesis (6/26 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.17

Use Curated BLAST to search for 4.2.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MEB0 at UniProt or InterPro

Protein Sequence (258 amino acids)

>H281DRAFT_05725 2,3-dehydroadipyl-CoA hydratase / enoyl-CoA hydratase (EC 4.2.1.17) (Paraburkholderia bryophila 376MFSha3.1)
MVYENILVETRGRVGLVTLNRPKALNALNDALMDELGAALREFDADDAIGAIVLTGSEKA
FAAGADIGMMSTYSYMDVYKGDYITRNWETVRSIRKPIIAAVAGFALGGGCELAMMCDMI
FAADTAKFGQPEIKLGIMPGAGGTQRLPRAVSKAKAMDLCLTARFMDAAEAERAGLVSRV
IPAASLIDEAIAAAATIAEFPLPAVMMVKESVNRAYETTLAEGVHFERRLFHSLFATEDQ
KEGMAAFVEKRKPVFKHR