Protein Info for H281DRAFT_05724 in Paraburkholderia bryophila 376MFSha3.1

Updated annotation (from data): 3-oxo-5,6-didehydrosuberyl-CoA semialdehyde dehydrogenase PaaZ (EC:1.2.1.91)
Rationale: Specifically important for utilization of phenylacetate. This dehydrogenase (also known as PaaZ) is part of the aerobic phenylacetyl-CoA degradation pathway. 86% identical to BCAL0408 from B. cenocepacia, which is also involved in phenylacetate degradation and was proposed to be PaaZ (PMC2580687).
Original annotation: phenylacetic acid degradation protein paaN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02288: phenylacetic acid degradation protein paaN
  • amino acids 3 to 556 (554 residues), 896.2 bits, E=3.2e-274
• PF00171: Aldedh
  • amino acids 86 to 503 (418 residues), 112.3 bits, E=2.2e-36
• PF05893: LuxC
  • amino acids 316 to 379 (64 residues), 23.3 bits, E=2.8e-09

Best Hits

KEGG orthology group: None (inferred from 94% identity to bug:BC1001_3125)

Predicted SEED Role

"Aldehyde dehydrogenase (EC 1.2.1.3), PaaZ" in subsystem Aromatic Amin Catabolism (EC 1.2.1.3)

MetaCyc Pathways

• phenylacetate degradation I (aerobic) (9/9 steps found)
• superpathway of phenylethylamine degradation (9/11 steps found)
• ethanol degradation II (3/3 steps found)
• ethanol degradation IV (3/3 steps found)
• octane oxidation (4/5 steps found)
• superpathway of NAD/NADP - NADH/NADPH interconversion (yeast) (6/8 steps found)
• phytol degradation (3/4 steps found)
• ethanol degradation III (2/3 steps found)
• hypotaurine degradation (2/3 steps found)
• mitochondrial NADPH production (yeast) (3/5 steps found)
• L-tryptophan degradation X (mammalian, via tryptamine) (2/4 steps found)
• fatty acid α-oxidation I (plants) (2/4 steps found)
• putrescine degradation III (2/4 steps found)
• histamine degradation (1/3 steps found)
• 3-methyl-branched fatty acid α-oxidation (3/6 steps found)
• serotonin degradation (3/7 steps found)
• dopamine degradation (1/5 steps found)
• ceramide degradation by α-oxidation (2/7 steps found)
• sphingosine and sphingosine-1-phosphate metabolism (4/10 steps found)
• alkane oxidation (1/6 steps found)
• aromatic biogenic amine degradation (bacteria) (2/8 steps found)
• limonene degradation IV (anaerobic) (1/7 steps found)
• noradrenaline and adrenaline degradation (4/13 steps found)
• ceramide and sphingolipid recycling and degradation (yeast) (4/16 steps found)

KEGG Metabolic Maps

• 1,2-Dichloroethane degradation
• 3-Chloroacrylic acid degradation
• Arginine and proline metabolism
• Ascorbate and aldarate metabolism
• Butanoate metabolism
• Fatty acid metabolism
• Glycerolipid metabolism
• Glycolysis / Gluconeogenesis
• Histidine metabolism
• Limonene and pinene degradation
• Lysine degradation
• Propanoate metabolism
• Pyruvate metabolism
• Tryptophan metabolism
• Urea cycle and metabolism of amino groups
• Valine, leucine and isoleucine degradation
• beta-Alanine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.3

Use Curated BLAST to search for 1.2.1.3 or 1.2.1.91

Protein Sequence (566 amino acids)

>H281DRAFT_05724 3-oxo-5,6-didehydrosuberyl-CoA semialdehyde dehydrogenase PaaZ (EC:1.2.1.91) (Paraburkholderia bryophila 376MFSha3.1)
MTHPLFTKHEDTLQKALAAVETRGYWSPFVEMPSPKVYGETANADGEAAFKAHLNATFEL
DQPSTGETVGTEVSPFGFPLGIRYPKSDPDALLAAAAEAQRDWRAAGPQAWIGVSLEILA
RLNRASFEIGYSVMHTTGQAFMMAFQAGGPHAQDRALEAVVYAWDQLRRIPADAHWEKPQ
GKNPPLAMQKRYTIVPRGTALVLGCCTFPTWNGYPGLFADLATGNAVIVKPHPGAILPLA
VTVRIARDVLREAGFDPNVVTLLATEPNDGAIVQSLAVRPEIKLIDFTGSTQNGTWLERN
AHQAQVYTEKAGVNQIVIDSADDIKAVARNIAFSLALYSGQMCTAPQNIYVPRDGIQTAD
GTLSFDEVAQAIAGAVQKLVADPARAVELLGAIQNEGVAQRVDEAATLGRVLVESQALEH
PAFAGARVRTPLVLQLDAATDGEQFTKEWFGPISFVIATDSTAHSLDLAGTIAAEHGALT
LSVYSTDEAVLDQAHEASIRGGVALSINLTGGVFVNQSAAFSDFHGTGANPAANAALADA
AFVANRFRVIQSRVHVEPKAAPAVAG