Protein Info for H281DRAFT_05724 in Paraburkholderia bryophila 376MFSha3.1

Updated annotation (from data): 3-oxo-5,6-didehydrosuberyl-CoA semialdehyde dehydrogenase PaaZ (EC:1.2.1.91)
Rationale: Specifically important for utilization of phenylacetate. This dehydrogenase (also known as PaaZ) is part of the aerobic phenylacetyl-CoA degradation pathway. 86% identical to BCAL0408 from B. cenocepacia, which is also involved in phenylacetate degradation and was proposed to be PaaZ (PMC2580687).
Original annotation: phenylacetic acid degradation protein paaN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 566 TIGR02288: phenylacetic acid degradation protein paaN" amino acids 3 to 556 (554 residues), 896.2 bits, see alignment E=3.2e-274 PF00171: Aldedh" amino acids 86 to 503 (418 residues), 112.3 bits, see alignment E=2.2e-36 PF05893: LuxC" amino acids 316 to 379 (64 residues), 23.3 bits, see alignment E=2.8e-09

Best Hits

KEGG orthology group: None (inferred from 94% identity to bug:BC1001_3125)

Predicted SEED Role

"Aldehyde dehydrogenase (EC 1.2.1.3), PaaZ" in subsystem Aromatic Amin Catabolism (EC 1.2.1.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.3

Use Curated BLAST to search for 1.2.1.3 or 1.2.1.91

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (566 amino acids)

>H281DRAFT_05724 3-oxo-5,6-didehydrosuberyl-CoA semialdehyde dehydrogenase PaaZ (EC:1.2.1.91) (Paraburkholderia bryophila 376MFSha3.1)
MTHPLFTKHEDTLQKALAAVETRGYWSPFVEMPSPKVYGETANADGEAAFKAHLNATFEL
DQPSTGETVGTEVSPFGFPLGIRYPKSDPDALLAAAAEAQRDWRAAGPQAWIGVSLEILA
RLNRASFEIGYSVMHTTGQAFMMAFQAGGPHAQDRALEAVVYAWDQLRRIPADAHWEKPQ
GKNPPLAMQKRYTIVPRGTALVLGCCTFPTWNGYPGLFADLATGNAVIVKPHPGAILPLA
VTVRIARDVLREAGFDPNVVTLLATEPNDGAIVQSLAVRPEIKLIDFTGSTQNGTWLERN
AHQAQVYTEKAGVNQIVIDSADDIKAVARNIAFSLALYSGQMCTAPQNIYVPRDGIQTAD
GTLSFDEVAQAIAGAVQKLVADPARAVELLGAIQNEGVAQRVDEAATLGRVLVESQALEH
PAFAGARVRTPLVLQLDAATDGEQFTKEWFGPISFVIATDSTAHSLDLAGTIAAEHGALT
LSVYSTDEAVLDQAHEASIRGGVALSINLTGGVFVNQSAAFSDFHGTGANPAANAALADA
AFVANRFRVIQSRVHVEPKAAPAVAG