Protein Info for H281DRAFT_05722 in Paraburkholderia bryophila 376MFSha3.1

Updated annotation (from data): 1,2-epoxyphenylacetyl-CoA isomerase (EC 5.3.3.18)
Rationale: Specifically important for phenylacetate utilization. This is part of the aerobic phenylacetyl-CoA pathway.
Original annotation: short chain enoyl-CoA hydratase /Enoyl-CoA hydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02280: phenylacetate degradation probable enoyl-CoA hydratase PaaB
  • amino acids 11 to 263 (253 residues), 415.5 bits, E=4.1e-129
• PF00378: ECH_1
  • amino acids 14 to 262 (249 residues), 238.6 bits, E=7.1e-75
• PF16113: ECH_2
  • amino acids 17 to 208 (192 residues), 102.8 bits, E=2.8e-33

Best Hits

Swiss-Prot: 59% identical to PAAG_ECOLI: 1,2-epoxyphenylacetyl-CoA isomerase (paaG) from Escherichia coli (strain K12)

KEGG orthology group: K01692, enoyl-CoA hydratase [EC: 4.2.1.17] (inferred from 95% identity to bpy:Bphyt_3488)

MetaCyc: 60% identical to 1,2-epoxyphenylacetyl-CoA isomerase (Pseudomonas sp. Y2)
RXN0-6510 [EC: 5.3.3.18]

Predicted SEED Role

"Phenylacetate degradation enoyl-CoA hydratase PaaA (EC 4.2.1.17)" (EC 4.2.1.17)

MetaCyc Pathways

• oleate β-oxidation (29/35 steps found)
• phenylacetate degradation I (aerobic) (9/9 steps found)
• adipate degradation (5/5 steps found)
• superpathway of phenylethylamine degradation (9/11 steps found)
• benzoyl-CoA biosynthesis (3/3 steps found)
• adipate biosynthesis (4/5 steps found)
• benzoyl-CoA degradation I (aerobic) (5/7 steps found)
• fatty acid β-oxidation I (generic) (5/7 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (10/14 steps found)
• valproate β-oxidation (6/9 steps found)
• fatty acid β-oxidation II (plant peroxisome) (3/5 steps found)
• fatty acid β-oxidation IV (unsaturated, even number) (3/5 steps found)
• 2-methyl-branched fatty acid β-oxidation (9/14 steps found)
• methyl ketone biosynthesis (engineered) (3/6 steps found)
• (8E,10E)-dodeca-8,10-dienol biosynthesis (6/11 steps found)
• fatty acid β-oxidation VI (mammalian peroxisome) (3/7 steps found)
• 3-phenylpropanoate degradation (5/10 steps found)
• benzoate biosynthesis I (CoA-dependent, β-oxidative) (4/9 steps found)
• benzoate biosynthesis III (CoA-dependent, non-β-oxidative) (1/5 steps found)
• (4Z,7Z,10Z,13Z,16Z)-docosapentaenoate biosynthesis (6-desaturase) (2/13 steps found)
• docosahexaenoate biosynthesis III (6-desaturase, mammals) (2/14 steps found)
• Spodoptera littoralis pheromone biosynthesis (4/22 steps found)
• platensimycin biosynthesis (6/26 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Caprolactam degradation
• Fatty acid elongation in mitochondria
• Fatty acid metabolism
• Geraniol degradation
• Limonene and pinene degradation
• Lysine degradation
• Propanoate metabolism
• Tryptophan metabolism
• Valine, leucine and isoleucine degradation
• alpha-Linolenic acid metabolism
• beta-Alanine metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.17

Use Curated BLAST to search for 4.2.1.17 or 5.3.3.18

Sequence Analysis Tools

See A0A2Z5MDW0 at UniProt or InterPro

Protein Sequence (263 amino acids)

>H281DRAFT_05722 1,2-epoxyphenylacetyl-CoA isomerase (EC 5.3.3.18) (Paraburkholderia bryophila 376MFSha3.1)
MAYEAIGLDIDAASRVATITLNRPDKLNSFTRAMHQELNAALNEVETSGARALVLTGAGR
GFCAGQDLADLDFTPGAMTDLGELIDLHFNPLIRRLQALPLPVIAAVNGTAAGAGANLAL
ACDIVLAARSASFIQAFVKIGLVPDSGGTWFLPQRVGMARALGLAITGDKLSAEKAESWG
LIWQTVDDQELAATAAKLAAQLAQQPTRAIAAIKQAMRAGATQTLDQQLDLERDLQRELG
ASHDYAEGVQAFVEKRAPRFEGR