Protein Info for H281DRAFT_05721 in Paraburkholderia bryophila 376MFSha3.1

Annotation: acyl-CoA thioesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 TIGR00369: uncharacterized domain 1" amino acids 30 to 142 (113 residues), 86.9 bits, see alignment E=1.1e-28 TIGR02286: phenylacetic acid degradation protein PaaD" amino acids 32 to 143 (112 residues), 157.4 bits, see alignment E=1.4e-50 PF03061: 4HBT" amino acids 60 to 134 (75 residues), 50.2 bits, see alignment E=1.4e-17

Best Hits

KEGG orthology group: K02614, phenylacetic acid degradation protein (inferred from 92% identity to bug:BC1001_3128)

Predicted SEED Role

"Phenylacetic acid degradation protein PaaD, thioesterase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (162 amino acids)

>H281DRAFT_05721 acyl-CoA thioesterase (Paraburkholderia bryophila 376MFSha3.1)
MSTQPLYPAEMTPDELARATAAAMYENDACSRALGLEIMEVRAGYARLRMAVRDDFLNGH
QICHGGLIFTLADSTFAFACNSYNLNTVASGCSIEFLRPVHGGDVLTAEAVEQTLSGRTG
IYDIRVTNRAGDTVAMFRGKSAQIKGNVIPPIASRTAGASPD