Protein Info for H281DRAFT_05719 in Paraburkholderia bryophila 376MFSha3.1

Annotation: membrane-bound lytic murein transglycosylase A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03562: MltA
  • amino acids 138 to 279 (142 residues), 167.6 bits, E=2.5e-53
• PF06725: 3D
  • amino acids 307 to 380 (74 residues), 88.5 bits, E=2.7e-29

Best Hits

KEGG orthology group: K08304, membrane-bound lytic murein transglycosylase A [EC: 3.2.1.-] (inferred from 96% identity to bug:BC1001_3130)

Predicted SEED Role

"Membrane-bound lytic murein transglycosylase A precursor (EC 3.2.1.-)" (EC 3.2.1.-)

KEGG Metabolic Maps

• Ascorbate and aldarate metabolism
• Glycosaminoglycan degradation
• Nucleotide sugars metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Sequence Analysis Tools

See A0A2Z5MGD8 at UniProt or InterPro

Protein Sequence (384 amino acids)

>H281DRAFT_05719 membrane-bound lytic murein transglycosylase A (Paraburkholderia bryophila 376MFSha3.1)
MAVSIKNEHCRRFVRATGAWLSALSVAAILAACGGGGAVRPVVSPPTGAAIIPGQISATR
LTPVAWQQVPGWQDDSLIGATAALRQNCVRLARQANWARACAAAAQLDDLDATSARAFFE
AYFTPFQLANTDGTLDGLVTGYYEPLLRGSRTRHGVYQTALYRWPSSYRPGAAMPPRAQL
ERMGVLNGNELVWVDDPIEAFFLQVQGSGRIVMEDGSVMRLGFGGTNNQPYKSIGRWLLD
RGELTPAQATMQGIKAWARANPNRVDALLDTNPRFVFFREMPSAEGVSKAGADGPIGALG
VPLTPERSIAVDPTSIPLGTPVFLQTTRPLTNSPMNRLVFAQDTGSAIKGGVRADYFWGL
GDDAGDLAGKMKQGGRMWLLLPNS