Protein Info for H281DRAFT_05716 in Paraburkholderia bryophila 376MFSha3.1

Annotation: phosphoglycolate phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 PF00702: Hydrolase" amino acids 16 to 196 (181 residues), 109.8 bits, see alignment E=4.6e-35 PF12710: HAD" amino acids 18 to 189 (172 residues), 32.9 bits, see alignment E=1.8e-11 PF13419: HAD_2" amino acids 19 to 202 (184 residues), 116.8 bits, see alignment E=2.5e-37 TIGR01449: phosphoglycolate phosphatase, bacterial" amino acids 19 to 227 (209 residues), 202.7 bits, see alignment E=7.7e-64 TIGR01549: HAD hydrolase, family IA, variant 1" amino acids 74 to 196 (123 residues), 36.2 bits, see alignment E=1.2e-12 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 86 to 200 (115 residues), 38.1 bits, see alignment E=2.5e-13 PF13242: Hydrolase_like" amino acids 159 to 227 (69 residues), 42.3 bits, see alignment E=1.2e-14

Best Hits

Swiss-Prot: 44% identical to GPH_NITMU: Phosphoglycolate phosphatase (Nmul_A2370) from Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)

KEGG orthology group: K01091, phosphoglycolate phosphatase [EC: 3.1.3.18] (inferred from 92% identity to bpy:Bphyt_3495)

Predicted SEED Role

"Phosphoglycolate phosphatase (EC 3.1.3.18)" in subsystem 2-phosphoglycolate salvage or Glycolate, glyoxylate interconversions or Photorespiration (oxidative C2 cycle) (EC 3.1.3.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.18

Use Curated BLAST to search for 3.1.3.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MEI2 at UniProt or InterPro

Protein Sequence (238 amino acids)

>H281DRAFT_05716 phosphoglycolate phosphatase (Paraburkholderia bryophila 376MFSha3.1)
MTASFPAPTFNGPRLQAAIIDLDGTMVDTADDFTAGLNGMLAQLDAVETSREEVVGYVGK
GSEHLIRSVLAPRFEAEHAQDRFDEALAIYQAEYAKINGLHTRLYPDVEAGLVALRDAGL
KLACVTNKPHRFALELLQQYGLAQYFSVVLGGDSLPKKKPDPLPMLTAAGQLGVEPCATV
AIGDSENDALAGRAAGMATLTVPYGYNHGQAIQTIKSDGIVASLLDAAKAIAAHQSTT