Protein Info for H281DRAFT_05686 in Paraburkholderia bryophila 376MFSha3.1
Annotation: cold-shock DNA-binding protein family
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 70% identical to CSPA_STIAD: Cold shock-like protein CspA (cspA) from Stigmatella aurantiaca (strain DW4/3-1)
KEGG orthology group: K03704, cold shock protein (beta-ribbon, CspA family) (inferred from 97% identity to bge:BC1002_2784)Predicted SEED Role
"Cold shock protein CspG"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A2Z5MEK8 at UniProt or InterPro
Protein Sequence (67 amino acids)
>H281DRAFT_05686 cold-shock DNA-binding protein family (Paraburkholderia bryophila 376MFSha3.1) METGTVKWFNDAKGFGFITPDGGGEDLFAHFSEIRTEGFKTLQENQKVTFEVKTGPKGKQ AANIKPV