Protein Info for H281DRAFT_05671 in Paraburkholderia bryophila 376MFSha3.1

Annotation: ubiquinol-cytochrome c reductase cytochrome c1 subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02167: Cytochrom_C1
  • amino acids 42 to 249 (208 residues), 62.2 bits, E=3e-21

Best Hits

KEGG orthology group: K00413, ubiquinol-cytochrome c reductase cytochrome c1 subunit [EC: 1.10.2.2] (inferred from 96% identity to bgf:BC1003_3142)

Predicted SEED Role

"ubiquinol cytochrome C oxidoreductase, cytochrome C1 subunit" in subsystem Ubiquinone Menaquinone-cytochrome c reductase complexes

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.10.2.2

Use Curated BLAST to search for 1.10.2.2

Sequence Analysis Tools

See A0A2Z5MG70 at UniProt or InterPro

Protein Sequence (251 amino acids)

>H281DRAFT_05671 ubiquinol-cytochrome c reductase cytochrome c1 subunit (Paraburkholderia bryophila 376MFSha3.1)
MKKLLSTCALIGATLLAVLSGPAYADENVHLDRAPDNADNFASLQHGAQLFVNYCLNCHS
ANLVRYNRLTDLGIAPAEIQSNLLFTTDKVGNTMTVAMRPDDAKAWFGASPPDLSVEARA
RGKDWLYTYLRSFYRDNTRPTGWNNLVYENVSMPHVLWQLQGQRTAKFGEEVDEKTGETV
HKFVGFQQVTPGTMSPVDYDSAVADLVSYLSWMSEPTQKTRKQLGVWVLMFLGILSFFAW
RLNAAYWKHIK