Protein Info for H281DRAFT_05639 in Paraburkholderia bryophila 376MFSha3.1
Annotation: thiazole-phosphate synthase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 88% identical to THIG_BURTA: Thiazole synthase (thiG) from Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CIP 106301 / E264)
KEGG orthology group: K03149, thiamine biosynthesis ThiG (inferred from 98% identity to bpy:Bphyt_3573)MetaCyc: 44% identical to thiazole synthase (Bacillus subtilis subtilis 168)
THIAZOLSYN2-RXN [EC: 2.8.1.10]
Predicted SEED Role
"Thiazole biosynthesis protein ThiG" in subsystem Thiamin biosynthesis
MetaCyc Pathways
- superpathway of thiamine diphosphate biosynthesis II (10/11 steps found)
- thiazole component of thiamine diphosphate biosynthesis II (6/7 steps found)
- superpathway of thiamine diphosphate biosynthesis I (8/10 steps found)
- thiazole component of thiamine diphosphate biosynthesis I (4/6 steps found)
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.8.1.10
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A2Z5MI94 at UniProt or InterPro
Protein Sequence (273 amino acids)
>H281DRAFT_05639 thiazole-phosphate synthase (Paraburkholderia bryophila 376MFSha3.1) MQMTTPQAADALTLYGQPFASRVLLGTSRYPSLQSLSDSIDAARPGMVTVALRRQMNEGG AEAGFFDLLKHHGVPLLPNTAGCLTVGEAVATAHMAREIFETEWIKLELIGDDYTLQPDP VGLIEAAAKLVKDGFKVLPYCTEDLVIGRRLLDAGCEALMPWGAPIGTGKGVINPYGLRV LRERLPDVPLIVDAGLGVPSHAAQVMEWGFDGVLLNTAVSQATHPDAMARAFALGVEAGR QAFLAGPMAERESAHASTPVVGMPFWHQDGSAA