Protein Info for H281DRAFT_05606 in Paraburkholderia bryophila 376MFSha3.1

Annotation: diaminopimelate decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01048: diaminopimelate decarboxylase
  • amino acids 10 to 415 (406 residues), 516.6 bits, E=1.9e-159
• PF00278: Orn_DAP_Arg_deC
  • amino acids 32 to 373 (342 residues), 89.4 bits, E=2.3e-29
• PF01168: Ala_racemase_N
  • amino acids 37 to 236 (200 residues), 26.1 bits, E=1e-09
• PF02784: Orn_Arg_deC_N
  • amino acids 42 to 284 (243 residues), 231.2 bits, E=1.9e-72

Best Hits

Swiss-Prot: 61% identical to DCDA_PSEAE: Diaminopimelate decarboxylase (lysA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01586, diaminopimelate decarboxylase [EC: 4.1.1.20] (inferred from 93% identity to bpy:Bphyt_3606)

Predicted SEED Role

"Diaminopimelate decarboxylase (EC 4.1.1.20)" in subsystem Lysine Biosynthesis DAP Pathway (EC 4.1.1.20)

MetaCyc Pathways

• aspartate superpathway (22/25 steps found)
• L-lysine biosynthesis I (9/9 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (15/18 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (12/15 steps found)
• L-lysine biosynthesis III (6/7 steps found)
• L-lysine biosynthesis VI (6/7 steps found)
• L-lysine biosynthesis II (7/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Lysine biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.20

Sequence Analysis Tools

See A0A2Z5MGR1 at UniProt or InterPro

Protein Sequence (420 amino acids)

>H281DRAFT_05606 diaminopimelate decarboxylase (Paraburkholderia bryophila 376MFSha3.1)
MTRPAFDYVNGVLHVEGVSAVSLAEQFGTPLYVYSRAALTDAWNAYAGACAGRRASVHVA
VKANSNLAVLNVFARLGAGFDIVSGGELARVLAAGGKAENTVFSGVGKHASEMREALAAG
VKCFNVESIPELDRLNTVAAEMGKIAPVSLRVNPDVDAKTHPYISTGLKSNKFGVAFEDA
RATYQAAAAMANLEVVGIDCHIGSQITEIAPYLDAVDKLLELVELIEKDGIAIRHIDVGG
GLGITYDDETPPDIGEFVRTVLDRIEARGHGHREVYFEPGRSLVGNAGVLLTRVEFLKPG
AEKNFAIVDAAMTELARPAMYEAYHAIDAVVERDVPAHVYDIVGPVCESGDWLGRERLLS
VEPGDLLVIRSAGAYGFVMSSNYNTRPRAAEVMVDGTQAHVVRAREEIQQLFAGETVLPA