Protein Info for H281DRAFT_05557 in Paraburkholderia bryophila 376MFSha3.1

Annotation: MFS transporter, AAHS family, benzoate transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 458 transmembrane" amino acids 22 to 47 (26 residues), see Phobius details amino acids 58 to 79 (22 residues), see Phobius details amino acids 87 to 106 (20 residues), see Phobius details amino acids 112 to 132 (21 residues), see Phobius details amino acids 144 to 166 (23 residues), see Phobius details amino acids 174 to 192 (19 residues), see Phobius details amino acids 255 to 275 (21 residues), see Phobius details amino acids 288 to 312 (25 residues), see Phobius details amino acids 319 to 337 (19 residues), see Phobius details amino acids 343 to 365 (23 residues), see Phobius details amino acids 385 to 403 (19 residues), see Phobius details amino acids 410 to 428 (19 residues), see Phobius details PF07690: MFS_1" amino acids 27 to 315 (289 residues), 125.4 bits, see alignment E=4e-40 amino acids 298 to 428 (131 residues), 44.9 bits, see alignment E=1.2e-15 PF00083: Sugar_tr" amino acids 31 to 397 (367 residues), 91.8 bits, see alignment E=6.9e-30 PF06779: MFS_4" amino acids 43 to 188 (146 residues), 38.2 bits, see alignment E=1.8e-13

Best Hits

KEGG orthology group: K05548, MFS transporter, AAHS family, benzoate transport protein (inferred from 61% identity to reh:H16_B1919)

Predicted SEED Role

"benzoate MFS transporter BenK" in subsystem Benzoate degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (458 amino acids)

>H281DRAFT_05557 MFS transporter, AAHS family, benzoate transport protein (Paraburkholderia bryophila 376MFSha3.1)
MQQIDVNKLVDGARLNRFHAKVLAWCLLVIIIDGYDISVAGAALPAIMKEMGVTASTAGF
MASSALFGMMFGAIVLGALSDRIGRRWTISISVFLFSVFTTAAGLTHDPVSFSAMRFIAG
LGIGGAMPNIVAQMTEYSPRRIRSFMTTLMFSGYAVGGILAAVIGKHFIADFGWQIVFLA
AGVPVLLIPFILGSMPESLSYLVAQGDEGRLSMIVSQIDPRARIGMGVSLLARADQRTGG
APVARLFQNGRGASTVMFWIAFFTGLFMVYALSSWLTKLMAMSGYSLGSALSFVIALNLG
AVVGAVGGGWLADRLHIKWVLVSMYALGAVFLYMMTFKTSTEVLYFVVGAVGACTTGAQI
VAYAYSGQFYPTSIRSTGIGMASGIGRLGAIVAPMLIGLIVSLKLPLEHNFLVIGAAGLI
GALALAFIDHGKSASGQYVDVGFSPTTGEASGLVDVRT