Protein Info for H281DRAFT_05548 in Paraburkholderia bryophila 376MFSha3.1

Annotation: succinyl-CoA:L-malate CoA transferase subunit B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 PF02515: CoA_transf_3" amino acids 8 to 378 (371 residues), 373.8 bits, see alignment E=4.9e-116

Best Hits

Swiss-Prot: 47% identical to SCCT_CHLAA: Succinyl-CoA--D-citramalate CoA-transferase (Caur_2266) from Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)

KEGG orthology group: K14472, succinyl-CoA:(S)- malate CoA transferase subunit B [EC: 2.8.3.-] (inferred from 53% identity to rru:Rru_A2550)

Predicted SEED Role

"L-carnitine dehydratase/bile acid-inducible protein F (EC 2.8.3.16)" (EC 2.8.3.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.8.3.-, 2.8.3.16

Use Curated BLAST to search for 2.8.3.- or 2.8.3.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (402 amino acids)

>H281DRAFT_05548 succinyl-CoA:L-malate CoA transferase subunit B (Paraburkholderia bryophila 376MFSha3.1)
MSTTKQALAGIRVLEMATYIAGPFCGTLLAEFGADVIKLEMPNVGDPCRRYGTPTEAEDA
TLMFLSEGRNKRSITADLRREEGADLVKRLVKEVDVVIENFQPGTLEGWGLGWEDLREHN
SKLVMARVTGFGQDGPARNRPGFGRIGVAFGGLGYITGYPDRPPTSPGTATLADYLSGLF
AANGVLTALRARDLHGVGQFIDIGLYESVFRILDEMAPAYAADGKVRERSGPASHHSVPH
SNFPTKDNRWVSIACTNDKIFERFAKAAGRGEAVGPDGKWSKYPDRRADEAAVNEFAVSW
TKSRTRDEILVACEEAQVPCGPIYAIDEIFEDPQYNARGNLLKVQDDRVGEITIPNVVPR
LSETPGFVRSLGPALGASNEEVYQSLGLTVEEIAVLRAANVI