Protein Info for H281DRAFT_05520 in Paraburkholderia bryophila 376MFSha3.1

Annotation: transcriptional regulator, TetR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 PF00440: TetR_N" amino acids 30 to 74 (45 residues), 33 bits, see alignment 4.1e-12 PF16925: TetR_C_13" amino acids 97 to 209 (113 residues), 142.1 bits, see alignment E=7.5e-46

Best Hits

Swiss-Prot: 44% identical to ACUR_RHOS4: Transcriptional regulator AcuR (acuR) from Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

KEGG orthology group: None (inferred from 52% identity to bmj:BMULJ_05169)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (218 amino acids)

>H281DRAFT_05520 transcriptional regulator, TetR family (Paraburkholderia bryophila 376MFSha3.1)
MNSEVTKARIPRRPRATRALDREHARDRLIRRGVELLAEHSFDGTGLDVITSGHGIPKGS
FYYHFASKQAYAEEVIDAYAAYFDARFDRLFGDETQSPLNQLRDYIKDGADGMARHDWRR
GCLVGNLAQELGAHNEAFRSKLNAVLDSWQLRISDCLKRAVAAGELDPTSDIDSLARFFW
IGWEGSLMRAKLTRSDEPLRCFANNYFRLLGHPQRVDS