Protein Info for H281DRAFT_05508 in Paraburkholderia bryophila 376MFSha3.1
Annotation: Alcohol dehydrogenase, class IV
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 33% identical to MEDH_BACMT: NAD-dependent methanol dehydrogenase (mdh) from Bacillus methanolicus
KEGG orthology group: None (inferred from 57% identity to pnu:Pnuc_1643)MetaCyc: 33% identical to NAD-dependent methanol dehydrogenase monomer (Bacillus methanolicus)
Methanol dehydrogenase. [EC: 1.1.1.244]
Predicted SEED Role
"Alcohol dehydrogenase (EC 1.1.1.1)" in subsystem Fermentations: Mixed acid or Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 1.1.1.1)
MetaCyc Pathways
- heterolactic fermentation (16/18 steps found)
- mixed acid fermentation (13/16 steps found)
- ethanolamine utilization (5/5 steps found)
- hexitol fermentation to lactate, formate, ethanol and acetate (15/19 steps found)
- superpathway of anaerobic sucrose degradation (15/19 steps found)
- 3-methylbutanol biosynthesis (engineered) (6/7 steps found)
- ethanol degradation II (3/3 steps found)
- ethanol degradation I (2/2 steps found)
- acetylene degradation (anaerobic) (4/5 steps found)
- pyruvate fermentation to isobutanol (engineered) (4/5 steps found)
- acetaldehyde biosynthesis I (1/1 steps found)
- methanol oxidation to formaldehyde II (1/1 steps found)
- superpathway of N-acetylneuraminate degradation (16/22 steps found)
- phytol degradation (3/4 steps found)
- L-isoleucine degradation II (2/3 steps found)
- L-leucine degradation III (2/3 steps found)
- L-valine degradation II (2/3 steps found)
- pyruvate fermentation to ethanol I (2/3 steps found)
- pyruvate fermentation to ethanol III (2/3 steps found)
- pyruvate fermentation to ethanol II (1/2 steps found)
- superpathway of fermentation (Chlamydomonas reinhardtii) (6/9 steps found)
- (S)-propane-1,2-diol degradation (3/5 steps found)
- L-phenylalanine degradation III (2/4 steps found)
- L-tyrosine degradation III (2/4 steps found)
- L-methionine degradation III (1/3 steps found)
- methanol oxidation to carbon dioxide (3/6 steps found)
- butanol and isobutanol biosynthesis (engineered) (4/8 steps found)
- cytidine-5'-diphosphate-glycerol biosynthesis (1/4 steps found)
- salidroside biosynthesis (1/4 steps found)
- serotonin degradation (3/7 steps found)
- superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (10/17 steps found)
- superpathway of Clostridium acetobutylicum solventogenic fermentation (7/13 steps found)
- phenylethanol biosynthesis (1/5 steps found)
- noradrenaline and adrenaline degradation (4/13 steps found)
- L-tryptophan degradation V (side chain pathway) (1/13 steps found)
KEGG Metabolic Maps
- 1- and 2-Methylnaphthalene degradation
- 3-Chloroacrylic acid degradation
- Drug metabolism - cytochrome P450
- Fatty acid metabolism
- Glycine, serine and threonine metabolism
- Glycolysis / Gluconeogenesis
- Metabolism of xenobiotics by cytochrome P450
- Methane metabolism
- Retinol metabolism
- Tyrosine metabolism
Isozymes
Compare fitness of predicted isozymes for: 1.1.1.1
Use Curated BLAST to search for 1.1.1.1 or 1.1.1.244
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (383 amino acids)
>H281DRAFT_05508 Alcohol dehydrogenase, class IV (Paraburkholderia bryophila 376MFSha3.1) MAGFKFQSPRALIAEPGVAARIGEVLEPLGVNSVLLVSDRGVKNAGLLEAPMAHLRTSGI AVECFFDVEADPSAATVQAAAQLARSSGVDCVVAIGGGSPMDVAKLAALLAKSGVDLEDI YGIHKTEGPRLRLVLVPTTAGTGSEATPISIVTTGAGEKKGVVCPVLLPDIAVLDAELTI GLPKHVSAATGIDAMVHAIEAYTSRSLKNPLSDCLAREALRLLGPHLERVCAQGHDVETR QAMLLGANLAGMAFANAPVAAVHALAYPIGARFHVPHGLSNSLMLPAVLRFNMTSAESLY AELASLLVPNAIGSPEELTRALLAYLTELPVKLGLPVRLRDVGITAEDLPDLAIDAMKQS RLLVNNPREVGYDDALAMYQEVF