Protein Info for H281DRAFT_05496 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Acetoin utilization deacetylase AcuC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00850: Hist_deacetyl
  • amino acids 29 to 336 (308 residues), 240.4 bits, E=1.4e-75

Best Hits

Swiss-Prot: 43% identical to APAH_MYCRA: Acetylpolyamine amidohydrolase (aphA) from Mycoplana ramosa

KEGG orthology group: None (inferred from 56% identity to pol:Bpro_0416)

MetaCyc: 43% identical to acetylpolyamine amidohydrolase subunit (Mycoplana ramosa)
Acetylputrescine deacetylase. [EC: 3.5.1.62]

Predicted SEED Role

No annotation

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.62

Protein Sequence (341 amino acids)

>H281DRAFT_05496 Acetoin utilization deacetylase AcuC (Paraburkholderia bryophila 376MFSha3.1)
MIPVLYTEAHRLHEPGFFFKAGAMGEAQEKRERADELLAAVKAAGYPTPVPEQLGIAPVA
AIHTPDYLCFLEEAYEMWRQIPEAGPEVVPNVFAVHGMTHGYPTRIVGRAGYHMQDLASP
MGEGTYVAAMAAANLAADAARRVAAGEHAAYALCRPPGHHAYADRGGGVCYLNNAAIAAQ
YLLRTARRVAIVDIDVHHGNGTQGVFYQRPDVFFVSLHRDPVDYHPYFCGYAQERGEGAG
LGYNLNLPLPAGTGDDAYLGALDFGLRRVEKFAPDALVVSLGLDAHELDPFQGLRITTDG
FARIAGKLAALKLPSVLVQEGGYDRANIGANLLSFFRGFAG