Protein Info for H281DRAFT_05492 in Paraburkholderia bryophila 376MFSha3.1

Annotation: putative spermidine/putrescine transport system ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 PF00005: ABC_tran" amino acids 23 to 165 (143 residues), 125.6 bits, see alignment E=2.3e-40 TIGR01187: polyamine ABC transporter, ATP-binding protein" amino acids 38 to 354 (317 residues), 377.1 bits, see alignment E=3.3e-117 PF08402: TOBE_2" amino acids 284 to 360 (77 residues), 53.9 bits, see alignment E=1.6e-18

Best Hits

Swiss-Prot: 48% identical to POTA_RUBXD: Spermidine/putrescine import ATP-binding protein PotA (potA) from Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129)

KEGG orthology group: K02052, putative spermidine/putrescine transport system ATP-binding protein (inferred from 55% identity to ebi:EbC_30910)

Predicted SEED Role

"Putrescine transport ATP-binding protein PotA (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (372 amino acids)

>H281DRAFT_05492 putative spermidine/putrescine transport system ATP-binding protein (Paraburkholderia bryophila 376MFSha3.1)
VESKSIIDFVGVQKSYDGENLVVKDLNLSIRRGEFLTLLGASGSGKTTTLMMLAGFETPT
LGGIWMNGKPIETVPAHKRGIGMVFQNYALFPHMTVEQNLAYPLRMRNVSRNETVAKVKR
AVDMVRLHGMERRRPSELSGGQQQRVALARAMVFEPELILMDEPLGALDKNLREHMQYEI
KQLHHELGVTVVYVTHDQAEAMTMSDRIAVFQQGVISQIGSPDELYERPANLDVASFIGE
SNRLTGTVVSVGSMVDTVRLTSGLSLEVPSTSPVREIDRVVEIVVRPERVSIEQGSADDQ
WQWLQGRVSDLTYLGDHLRVLLVTDSGDSFIAKVSGAYRALPSVGQELRFGWRTQDAHAF
QRSMHQPLSSLK