Protein Info for H281DRAFT_05437 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Sugar phosphate permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 transmembrane" amino acids 37 to 58 (22 residues), see Phobius details amino acids 69 to 93 (25 residues), see Phobius details amino acids 103 to 130 (28 residues), see Phobius details amino acids 166 to 184 (19 residues), see Phobius details amino acids 192 to 211 (20 residues), see Phobius details amino acids 247 to 270 (24 residues), see Phobius details amino acids 290 to 314 (25 residues), see Phobius details amino acids 327 to 345 (19 residues), see Phobius details amino acids 351 to 374 (24 residues), see Phobius details amino acids 392 to 409 (18 residues), see Phobius details amino acids 416 to 436 (21 residues), see Phobius details PF07690: MFS_1" amino acids 42 to 402 (361 residues), 211.2 bits, see alignment E=1e-66

Best Hits

Swiss-Prot: 44% identical to LGOT_ECOLI: Probable L-galactonate transporter (lgoT) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 97% identity to bph:Bphy_2392)

MetaCyc: 44% identical to galactonate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-227

Predicted SEED Role

"D-galactonate transporter" in subsystem D-galactonate catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (450 amino acids)

>H281DRAFT_05437 Sugar phosphate permease (Paraburkholderia bryophila 376MFSha3.1)
MEQSSTAPRAPESGSSNAQNIAPSDQASPRVRRIQRTALALLLLSGVINYIDRATLSIAN
PLIRQDLGLSVAEMGLLLSAFLWAYAFAQLPAGALVDRFGARVMLSISLATWSVAQAFGG
VVSSFGQFFAARMVLGIGEAPQFPTAAKVVRDWFGKKERGAATGIWNSSSTLGTAISAPL
LTVLMLTVGWRWMFGVMGIAGLLVALGFFILHRDPHQVELTQRERAYLSDVDGEAQSRPT
WREWRRLFEFSTTWGMLLGFFGTIYVLWLYNAWLPSYLQMELHLTIAKSGWVAAVPYLFG
VVGSLSGGKICDVLARRGVSAINSRKYPMAASLFGVAVFTVLTGLTHNVTLAVVFISISM
LLLYVSSSAAWATASVAAPANCTASIGAMQNFGGYFGGALAPVVTGFIVQQTHSFQPALF
VGAAVAAVAVIGYWLLVRGPIPPVALTRDV