Protein Info for H281DRAFT_05429 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 PF01425: Amidase" amino acids 31 to 410 (380 residues), 236.6 bits, see alignment E=3e-74

Best Hits

KEGG orthology group: None (inferred from 75% identity to bxe:Bxe_C1306)

Predicted SEED Role

"Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit and related amidases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (432 amino acids)

>H281DRAFT_05429 Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit (Paraburkholderia bryophila 376MFSha3.1)
MNQTSFYRPVSGLDLLKRIDGDARERGCISEEALGRIDDVDPHVRAMTAIARREAVVAAS
ASASGPLAGLPVAVKDIFDTSDLVTSFGSPIYEGYQPRSDATIVTLLRRNGGTIVGKTVT
SEFAYMAPTGTRNPCDIGRTAGGSSSGSAAAVAAGMVPFAIGSQTGGSTIRPASFCGIAG
YKPTLGLLPTVGMKCFSWSFDTIGLFAAGVRDVAYLAQVLSGRRLAVDVAPASPVFGVPD
GYPWTGASANATTALGTAVRSIERAGGRVRPVRFSTWMTDMIDAHETIQSFEAYQTLGYE
YDHHRAELSAKLSEFLDRASALDTATYVNACALMEQAKVRLSELFEGIDVLLTPSARDEA
PDGLGSTGDPAFNRNWTLLGCPCVNVPGLWGARGGPIGVQVIGRPGEDARSLAAAAFVEQ
AIAASAGRPRLM