Protein Info for H281DRAFT_05416 in Paraburkholderia bryophila 376MFSha3.1

Annotation: TIGR02594 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 151 TIGR02594: TIGR02594 family protein" amino acids 17 to 150 (134 residues), 136 bits, see alignment E=5e-44 PF05257: CHAP" amino acids 52 to 130 (79 residues), 28.3 bits, see alignment E=1e-10

Best Hits

KEGG orthology group: None (inferred from 78% identity to bug:BC1001_4442)

Predicted SEED Role

"Cell wall-associated hydrolases (invasion-associated proteins)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (151 amino acids)

>H281DRAFT_05416 TIGR02594 family protein (Paraburkholderia bryophila 376MFSha3.1)
MLEGFRYEPSATGFTPAWLDIAFKERGVSRYGPGESNPRIAEYNNTTQLAGYDDKISWCS
SFLNWCMKQSGIPGTGSALARSWLSWGNPLDAPRYGCVAVLTADDAVEWKGHVGFFIRSD
ADNVYLFGGNQLGEVRELAYPLERVLAYRWP