Protein Info for H281DRAFT_05406 in Paraburkholderia bryophila 376MFSha3.1

Annotation: putative spermidine/putrescine transport system permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 transmembrane" amino acids 35 to 57 (23 residues), see Phobius details amino acids 95 to 121 (27 residues), see Phobius details amino acids 136 to 159 (24 residues), see Phobius details amino acids 165 to 181 (17 residues), see Phobius details amino acids 222 to 245 (24 residues), see Phobius details amino acids 265 to 285 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 117 to 285 (169 residues), 47.1 bits, see alignment E=1.2e-16

Best Hits

KEGG orthology group: K02053, putative spermidine/putrescine transport system permease protein (inferred from 90% identity to bxe:Bxe_B1684)

Predicted SEED Role

"ABC-type spermidine/putrescine transport system, permease component II"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MHQ7 at UniProt or InterPro

Protein Sequence (296 amino acids)

>H281DRAFT_05406 putative spermidine/putrescine transport system permease protein (Paraburkholderia bryophila 376MFSha3.1)
MSTPVPSARLHRASPPPRWPRLSNALPGQLGKATALLAAIVLFVAALPILTMITMSFSAA
DTLEFPPHAYGLHWYRAAWQSFVSPDATSSLSMGAALSTSLIVALSTMLIATLVSVPAAY
ALSRYRFRGKPAVEQLVALPLVYPLVMLGLSLLLVFNVLPVELGVFRLIVAHVILALPFT
VKNCAASVASIGPEFEEAACVMGASPARALVDVILPLMRPGILAGMLFAFIVSFNEFTVT
FFLYTIDTMTLPVWLYSRTVSSLDPTVFCFAVFIVAIDFALIWLLEKLIGDEGVAL