Protein Info for H281DRAFT_05392 in Paraburkholderia bryophila 376MFSha3.1

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 369 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 39 to 64 (26 residues), see Phobius details amino acids 84 to 106 (23 residues), see Phobius details amino acids 139 to 159 (21 residues), see Phobius details amino acids 166 to 186 (21 residues), see Phobius details amino acids 198 to 213 (16 residues), see Phobius details amino acids 225 to 244 (20 residues), see Phobius details amino acids 263 to 281 (19 residues), see Phobius details amino acids 302 to 322 (21 residues), see Phobius details amino acids 329 to 349 (21 residues), see Phobius details PF10129: OpgC_C" amino acids 7 to 354 (348 residues), 345.2 bits, see alignment E=4.1e-107

Best Hits

KEGG orthology group: None (inferred from 92% identity to bgf:BC1003_5757)

Predicted SEED Role

"OpgC protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MHE6 at UniProt or InterPro

Protein Sequence (369 amino acids)

>H281DRAFT_05392 hypothetical protein (Paraburkholderia bryophila 376MFSha3.1)
MKPSQSRLVELDFFRGLVLLIIVVDHIGGSILSRVTLHAYALCDAAEVFVFLGGFATATA
YAALAERRSETIARNRFLRRSLEIYRAFLVTAGLMLLVSAVLNAFSIEAPNLAITDLDDL
MDTPVAAMRDILLFRRQPYLASVLPMYAFFALLVPMILPLARSKPWLLLAGSVALWAGAP
AINAYLPAAPDMHWDFNPFAWQLLFVLGALARCQPVYQRVSEHRLGWLVTFAACSVVALA
AYYKLFIEREPLDASFKQNLSYLRAVNFLAIAWLVANLIELGWAKKLAESLPLIGVIGRK
GLLCFIAGAVISLVVDSVLYAATDGYLNYPLGLLADACAVTALFAVACGTEPLKRLVTRL
FTTRLRTSP