Protein Info for H281DRAFT_05390 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Predicted PurR-regulated permease PerM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 transmembrane" amino acids 30 to 47 (18 residues), see Phobius details amino acids 53 to 71 (19 residues), see Phobius details amino acids 83 to 107 (25 residues), see Phobius details amino acids 179 to 200 (22 residues), see Phobius details amino acids 233 to 254 (22 residues), see Phobius details amino acids 260 to 288 (29 residues), see Phobius details amino acids 294 to 315 (22 residues), see Phobius details amino acids 327 to 361 (35 residues), see Phobius details PF01594: AI-2E_transport" amino acids 33 to 361 (329 residues), 106.2 bits, see alignment E=1e-34

Best Hits

KEGG orthology group: None (inferred from 91% identity to bgf:BC1003_5755)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MH55 at UniProt or InterPro

Protein Sequence (366 amino acids)

>H281DRAFT_05390 Predicted PurR-regulated permease PerM (Paraburkholderia bryophila 376MFSha3.1)
MNSRPPVPPPDSTHSTELPATPGRVKKQRAASLVLYIGLVLLALWVVRDFIPVVAWAGVL
AIALWPLLRKVEGNRWLTGRTTLIAAVLTLAIALLVVLPVGIGIAQALREARDLSEWFKT
AQENGIAMPDFLHRLPFGAQQVAAWWQTYLAPPLRDSAAMKGLHSTTVVTLGRHFGARAV
HAVTVFAFMLVTLFVIFQAGPRLSGALSRGLRRGFGEDGAQLVQRMATAVRGTVSGLVVV
GLGEGALLGVAYFVTGLPHVALLALITAIAAMLPFCAPITFSLAALWLFSQGSVAGAIGL
LVFGAIVVFVAEHFVRPVLIGNSTRLPFLLVLFGILGGAETFGLLGLFIGPALMTVLMVL
WTDLVQ