Protein Info for H281DRAFT_05369 in Paraburkholderia bryophila 376MFSha3.1

Annotation: type VI secretion system protein VasG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 891 TIGR03345: type VI secretion ATPase, ClpV1 family" amino acids 12 to 879 (868 residues), 1296.7 bits, see alignment E=0 PF02861: Clp_N" amino acids 28 to 74 (47 residues), 38.2 bits, see alignment 5e-13 PF00004: AAA" amino acids 233 to 363 (131 residues), 37.2 bits, see alignment E=1.5e-12 amino acids 626 to 744 (119 residues), 28.8 bits, see alignment E=6.2e-10 PF17871: AAA_lid_9" amino acids 374 to 467 (94 residues), 102.5 bits, see alignment E=4.4e-33 PF07724: AAA_2" amino acids 621 to 789 (169 residues), 193.4 bits, see alignment E=1.2e-60 PF07728: AAA_5" amino acids 626 to 746 (121 residues), 40.7 bits, see alignment E=9.7e-14 PF10431: ClpB_D2-small" amino acids 796 to 866 (71 residues), 39.4 bits, see alignment E=2.1e-13

Best Hits

Swiss-Prot: 52% identical to CLPV1_PSEAE: Protein ClpV1 (clpV1) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K11907, type VI secretion system protein VasG (inferred from 94% identity to bpy:Bphyt_4919)

Predicted SEED Role

"ClpB protein" in subsystem Protein chaperones or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MJG0 at UniProt or InterPro

Protein Sequence (891 amino acids)

>H281DRAFT_05369 type VI secretion system protein VasG (Paraburkholderia bryophila 376MFSha3.1)
MSTSLNTLIAKLNPTCRQAALLAANNCLARGHYEVDLEHLLLALLDEPASDVALVLRASR
IDPHALRADIERELQRLKTGNTRTPVFSKQLIDLLEQAWLIASLDSQIGRIRSGHLLLAL
LSAPDLAQFAERMSPLLGDVRVTDLKHKFDELTAGSREVERSDAAQSPDESANDAARADA
AVGAPSKTPALDTYTSNLTQRAREGKIDPVIGREGEIRQTIDILMRRRQNNPIMTGEAGV
GKTAVVEGLALRIAADDVPAPLKGVALHVLDMGLLQAGASVKGEFENRLKNVIDEVKKSP
HPIILFIDEAHTIIGAGGQAGQNDAANLLKPALARGELRTIAATTWSEYKKYFEKDAALA
RRFQVVKIEEPSETLAAAMLRGMASLMEKHFNVRVLDDAITEAVRLSHRYISGRQLPDKA
ISVLDTACAKVALAHSSTPAAIDDTKKRLERIDAEIAALEREVASGALHDERLAQLRELR
EEDLKDLAEDEARYDKERALVSEIVGLRAEIDAARVSSADAEQAAKAQQARETLAVRVAE
LHALQGGQPMVPLQVDGHVVAEIVASWTGIPLGRMVKDEIQTVLNLQPLLGARVIGQDHA
LEAIAQRVRTASANLEDPNKPRGVFMFVGPSGVGKTETALALADVLYGGERKMVTINMSE
YQEAHSVSGLKGSPPGYVGYGEGGVLTEAVRRNPYSVVLLDEVEKAHPDVLEMFFQVFDK
GTMDDAEGREIDFRNTLIILTSNVGSQAVMQACLNKTAEELPDADALAETLRPQLYKAFK
PAFLGRMKVVPYYPISDDVLAEIIALKLERIRRRIESNHKAVFEWDESLVDAVLARCTEV
DSGARNVDHILNGTLLPEVAQHVLERIANGVAIQRISVRASEAGEFEYAVA