Protein Info for H281DRAFT_05350 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Signal transduction histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 616 transmembrane" amino acids 18 to 40 (23 residues), see Phobius details amino acids 192 to 213 (22 residues), see Phobius details PF00512: HisKA" amino acids 245 to 310 (66 residues), 46.9 bits, see alignment E=4.8e-16 PF13581: HATPase_c_2" amino acids 349 to 462 (114 residues), 27.5 bits, see alignment E=5.5e-10 PF02518: HATPase_c" amino acids 357 to 466 (110 residues), 103.5 bits, see alignment E=1.9e-33 PF00072: Response_reg" amino acids 489 to 606 (118 residues), 69 bits, see alignment E=7.6e-23

Best Hits

KEGG orthology group: None (inferred from 91% identity to bug:BC1001_5626)

Predicted SEED Role

"sensor histidine kinase/response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MHI2 at UniProt or InterPro

Protein Sequence (616 amino acids)

>H281DRAFT_05350 Signal transduction histidine kinase (Paraburkholderia bryophila 376MFSha3.1)
MADQGTHSQVTRRPWRRVLYVLIWLTALAAPAGAIGYLLYANLLNPGTTESLTGSYDGFY
WDAAQLQIAYARFENQLLLYQAGVDDDYQRLTLRYQLLQSKLHVMEGSTLRLTTQVALVQ
RQLDEIHALDRMLTELAPQVASLPNDRSGVNRIVAQLRQHWNEVNDLALSRRFADVADRE
AMNRDYIDKRRLLFAGGMILLLLSAAATLLLVVNGRRRTRLMHQQHAALEAEHQASRAAR
EASLAKDAFLGMISHELRTPLHAIVSSIELLGFNYHSEADRKVIQRLETAARHLEAQMKD
LTDYARLGAGKLELRHEHFEPRELLASIVDEHAMSAAARGLTLESEASGVSGLVDSDPHR
IRQIVNNLVTNAIRYTETGTVRVKLMQRPALLSFIVSDTGPGVPQAQIPLIFEEFTQLDS
SRTRRFEGAGMGLAIVQGLVRLFGGSVEVSSMVGEGTTFTVTIPVTPVASAQAPGVTARA
EPGGARPSVLIVDDNRLMRESLGEMVAHMEFDAHAVANADDALAWLDAHRCDVVLLDLHM
PERDGYAFLADLAARGGPSSEVPVIVVSAYAPEAGAKHGGETENGALPFFEALLKPIHYG
DLRNALQRALASRHTV