Protein Info for H281DRAFT_05330 in Paraburkholderia bryophila 376MFSha3.1

Annotation: urea transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 46 to 66 (21 residues), see Phobius details amino acids 85 to 111 (27 residues), see Phobius details amino acids 124 to 143 (20 residues), see Phobius details amino acids 165 to 190 (26 residues), see Phobius details amino acids 198 to 218 (21 residues), see Phobius details amino acids 227 to 251 (25 residues), see Phobius details amino acids 253 to 253 (1 residues), see Phobius details amino acids 258 to 280 (23 residues), see Phobius details PF03253: UT" amino acids 14 to 281 (268 residues), 149.6 bits, see alignment E=5.7e-48

Best Hits

KEGG orthology group: K08717, urea transporter (inferred from 75% identity to bug:BC1001_5608)

Predicted SEED Role

"Eukaryotic-type low-affinity urea transporter" in subsystem Urea decomposition

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (287 amino acids)

>H281DRAFT_05330 urea transporter (Paraburkholderia bryophila 376MFSha3.1)
MHAAATEAHSAALRTLLRSFGQIVLQANAFTGACLVASWMLCDPRLACAALIGAVAANVS
AILAAHSDDDLRAGLYGFNGALAGLAAFSFIADNATAAAVAILAATGTAWLHEPWSRWLR
ARQLSYFSSPCLIVTWLWMPIAASGPEPARLATTPTLDTAQFGGGVLAGLAQTGFASGAM
AGAFVLIGIAAASARHALCALTGAALASSLHVLLGAGASSFDASLLGFNGALTAIALTDC
GVLWMLGGVAISVALQAAAAHVGFAALSAPFVAATWSVQWLRQRAVR